Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032806 (Slc10a3)
Chromosomal location
Chr X: 71614556 - 71618644 (-)
Description
solute carrier family 10 (sodium/bile acid cotransporter family), member 3 Gene [Source:MGI (curated);Acc:Slc10a3-002]
Human Ortholog
not available
Omim not available
UniTrap UNI35131
Vector Insertion
Chr X: 71617952 - 71618586
Public Clones IST14466G3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114147
Sequence
GAAAAAATCCTGCTATCAAGGAAGAAAATATAGGACCAGGACCTTCCCATGGACCCTTCTCAGGACATTCCAACAGCACAAGCAAGGGTGTCTCCCTAAG

ACACAAGAGGCCTGAAAAAACTATCCTTTGTGAAGTGCCATGGTGGTCAAGAAAAGCAGAGGTAGCTCCCAGCAGTTGCCTGGCCTGGGAGGACAGGGTG

GTTGTACAGGTTTTGTAGGCATGCTTGGAACTGCCCTGCTGTTCATCAGCCTACCATGGGGAGCTCAAGTGATGGCCAGTGCCAACATCAGCACTGCTCT

GGGCCACACAAGTGGTCACTATTTGAGTATTGGGGATGGCTCAGTGACAGAATTTGATTTCCCTGAGAAGAGTGAGGGTATCATTGTGATCTCTAGCCAA

TACACTGGACAGACCAATGGGACAGGCCCCAGCCCCATACTTAAGGTTATATCCCTGGACACAGAGGTGCTGACCATTAAGAAT CTCATGGATTTCTAT

GAGGCCCCACCCCTGCTGATCGAAGAACGGAGAGATTTCTGCATCAGGGTGTCACCTGCTGAAGACCTCCCTTCTGCTCTCAACACCAACTTGGGCCACT

TCTCAGAGAACCCAATACTCTACTTGCTTCTGCCTCTTATCTTTGTCAACAAGTGTTCATTTGGTTGCAAAGTGGAACTTGAAGTTTTGAAGGAGCTCCT

ACAGAGCCCCCAACCCATGCTGTTGGGCCTCTTGGGCCAGTTTCTGGTCATGCCTTTCTATGCTTTCCTGATGGCCAAAGTCTTCATGCTACCCAAGGCC

TTAGCTCTGGGCCTCATCATTACCTGCTCATCACCTGGTGGTGGAGGGAGCTACCTCTTCAGTCTCCTCCTTGGAGGAGATGTCACCCTGGCCATCTCCA

TGACTTTCATCTCAACAGTAGCTGCCACTGGTTTCCTACCACTCTCATCAGCCATCTACAGCTACCTTCTCAGCATCCATGAAACACTCCACGTGCCCAT

CTCCAAGATATTGGGGACCCTGCTGTTTATCGCCATCCCCATAGCAGCGGGTGTGGTGATCAAATCTAAGCTCCCCAAGTTCTCTGAACTACTGTTACAG

GTCATCAAGCCCTTCAGCTTTATACTTCTCCTGGGTGGCCTGTTCCTGGCCTACCACATGGGGGTCTTCATCCTAGTGGGAGTCAGGTTACCCATTGTAC

TGGTGGGTTTCACAGTGCCTCTTGTTGGCCTCTTGGTGGGCTACAGCCTGGCCATCTGCCTGAAGCTGCCAGTGGCTCAGCGACGAACAGTCAGCATTGA

GGTAGGGGTGCAAAACAGCCTGCTAGCCTTAGCCATGCTACAGCTGTCTCTGCGCCGCCTTCAAGCAGACTATGCCTCTCAGGCCCCTTTCATTGTGGCA

CTGAGTGGTACCTCCGAGATGTTGGCTTTGGTTATTGGCCAGTTCATCTATAGCATCTTGTTTCCTGTTCCCTGAGCCCTCTGGATCAAGTTTTATAACT

TCCAGCCCCCATACTCCTCTCTTCCCACAGTTCTTGTGTACCGTACCAAAGGCCTTTAGTTCTCATGCACTATGCACTCAAGACAAATCCAGGCTTATTT

TTTTACTCCTTTTCGCCCCAGCTTTCAGTGCCAAAGAGGCCATGCTGAGTTAGATAGTTGGGTATTGCCCAGAAATATATTTCAATAAAAAAAAACCAAA

AAAACAAAA
Translation
MVVKKSRGSSQQLPGLGGQGGCTGFVGMLGTALLFISLPWGAQVMASANISTALGHTSGHYLSIGDGSVTEFDFPEKSEGIIVISSQYTGQTNGTGPSPI

LKVISLDTEVLTIKN LMDFYEAPPLLIEERRDFCIRVSPAEDLPSALNTNLGHFSENPILYLLLPLIFVNKCSFGCKVELEVLKELLQSPQPMLLGLLG

QFLVMPFYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFISTVAATGFLPLSSAIYSYLLSIHETLHVPISKILGTLLFIAI

PIAAGVVIKSKLPKFSELLLQVIKPFSFILLLGGLFLAYHMGVFILVGVRLPIVLVGFTVPLVGLLVGYSLAICLKLPVAQRRTVSIEVGVQNSLLALAM

LQLSLRRLQADYASQAPFIVALSGTSEMLALVIGQFIYSILFPVP
Transcript ENSMUST00000114146
Sequence
GCCACTACTTGTGAGGAGCTCTGTGGCCGCGGAAGCAA - UNI35131 - TTACCTTACTCTGGTTTTCCTGCCTCCCTCTTCATCAGCGAGATTCAA

GGCTGGACCAGGGCCCCCAGG - UNI35131 - GAAAAAATCCTGCTATCAAGGAAGAAAATATAGGACCAGGACCTTCCCATGGACCCTTCTCAGGA

CATTCCAACAGCACAAGCAAGGGTGTCTCCCTAAGACACAAGAGGCCTGAAAAAACTATCCTTTGTGAAGTGCCATGGTGGTCAAGAAAAGCAGAGGTAG

CTCCCAGCAGTTGCCTGGCCTGGGAGGACAGGGTGGTTGTACAGGTTTTGTAGGCATGCTTGGAACTGCCCTGCTGTTCATCAGCCTACCATGGGGAGCT

CAAGTGATGGCCAGTGCCAACATCAGCACTGCTCTGGGCCACACAAGTGGTCACTATTTGAGTATTGGGGATGGCTCAGTGACAGAATTTGATTTCCCTG

AGAAGAGTGAGGGTATCATTGTGATCTCTAGCCAATACACTGGACAGACCAATGGGACAGGCCCCAGCCCCATACTTAAGGTTATATCCCTGGACACAGA

GGTGCTGACCATTAAGAATGTGAGTGCCATAACCTGGAGCAGTGGAGGTGGCTTTGTGGTAGGCATCCACTCAGGTCTAGCTGGGCTGGCCCCACTCCAC

CTCCAGCTCATGGATTTCTATGAGGCCCCACCCCTGCTGATCGAAGAACGGAGAGATTTCTGCATCAGGGTGTCACCTGCTGAAGACCTCCCTTCTGCTC

TCAACACCAACTTGGGCCACTTCTCAGAGAACCCAATACTCTACTTGCTTCTGCCTCTTATCTTTGTCAACAAGTGTTCATTTGGTTGCAAAGTGGAACT

TGAAGTTTTGAAGGAGCTCCTACAGAGCCCCCAACCCATGCTGTTGGGCCTCTTGGGCCAGTTTCTGGTCATGCCTTTCTATGCTTTCCTGATGGCCAAA

GTCTTCATGCTACCCAAGGCCTTAGCTCTGGGCCTCATCATTACCTGCTCATCACCTGGTGGTGGAGGGAGCTACCTCTTCAGTCTCCTCCTTGGAGGAG

ATGTCACCCTGGCCATCTCCATGACTTTCATCTCAACAGTAGCTGCCACTGGTTTCCTACCACTCTCATCAGCCATCTACAGCTACCTTCTCAGCATCCA

TGAAACACTCCACGTGCCCATCTCCAAGATATTGGGGACCCTGCTGTTTATCGCCATCCCCATAGCAGCGGGTGTGGTGATCAAATCTAAGCTCCCCAAG

TTCTCTGAACTACTGTTACAGGTCATCAAGCCCTTCAGCTTTATACTTCTCCTGGGTGGCCTGTTCCTGGCCTACCACATGGGGGTCTTCATCCTAGTGG

GAGTCAGGTTACCCATTGTACTGGTGGGTTTCACAGTGCCTCTTGTTGGCCTCTTGGTGGGCTACAGCCTGGCCATCTGCCTGAAGCTGCCAGTGGCTCA

GCGACGAACAGTCAGCATTGAGGTAGGGGTGCAAAACAGCCTGCTAGCCTTAGCCATGCTACAGCTGTCTCTGCGCCGCCTTCAAGCAGACTATGCCTCT

CAGGCCCCTTTCATTGTGGCACTGAGTGGTACCTCCGAGATGTTGGCTTTGGTTATTGGCCAGTTCATCTATAGCATCTTGTTTCCTGTTCCCTGAGCCC

TCTGGATCAAGTTTTATAACTTCCAGCCCCCATACTCCTCTCTTCCCACAGTTCTTGTGTACCGTACCAAAGGCCTTTAGTTCTCATGCACTATGCACTC

AAGACAAATCCAGGCTTATTTTTTTACTCCTTTTCGCCCCAGCTTTCAGTGCCAAAGAGGCCATGCTGAGTTAGATAGTTGGGTATTGCCCAGAAATATA

TTTCAATAAAAAAAAACCAAAAAAACAAAA
Translation
 - UNI35131 -  - UNI35131 - MVVKKSRGSSQQLPGLGGQGGCTGFVGMLGTALLFISLPWGAQVMASANISTALGHTSGHYLSIGDGSVTEF

DFPEKSEGIIVISSQYTGQTNGTGPSPILKVISLDTEVLTIKNVSAITWSSGGGFVVGIHSGLAGLAPLHLQLMDFYEAPPLLIEERRDFCIRVSPAEDL

PSALNTNLGHFSENPILYLLLPLIFVNKCSFGCKVELEVLKELLQSPQPMLLGLLGQFLVMPFYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLL

LGGDVTLAISMTFISTVAATGFLPLSSAIYSYLLSIHETLHVPISKILGTLLFIAIPIAAGVVIKSKLPKFSELLLQVIKPFSFILLLGGLFLAYHMGVF

ILVGVRLPIVLVGFTVPLVGLLVGYSLAICLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGQFIYSILFPV

P
Transcript ENSMUST00000073067
Sequence
TGGGGGCGGGACGAGGCCCGGGCAGGACGGGCCTCACTTGCCGGCGTTTGCCGGCCCGGGCCACTACTTGTGAGGAGCTCTGTGGCCGCGGAAGCAAGTG

AGAGATTTCGACCAG - UNI35131 - GAAAAAATCCTGCTATCAAGGAAGAAAATATAGGACCAGGACCTTCCCATGGACCCTTCTCAGGACATTCC

AACAGCACAAGCAAGGGTGTCTCCCTAAGACACAAGAGGCCTGAAAAAACTATCCTTTGTGAAGTGCCATGGTGGTCAAGAAAAGCAGAGGTAGCTCCCA

GCAGTTGCCTGGCCTGGGAGGACAGGGTGGTTGTACAGGTTTTGTAGGCATGCTTGGAACTGCCCTGCTGTTCATCAGCCTACCATGGGGAGCTCAAGTG

ATGGCCAGTGCCAACATCAGCACTGCTCTGGGCCACACAAGTGGTCACTATTTGAGTATTGGGGATGGCTCAGTGACAGAATTTGATTTCCCTGAGAAGA

GTGAGGGTATCATTGTGATCTCTAGCCAATACACTGGACAGACCAATGGGACAGGCCCCAGCCCCATACTTAAGGTTATATCCCTGGACACAGAGGTGCT

GACCATTAAGAATGTGAGTGCCATAACCTGGAGCAGTGGAGGTGGCTTTGTGGTAGGCATCCACTCAGGTCTAGCTGGGCTGGCCCCACTCCACCTCCAG

CTCATGGATTTCTATGAGGCCCCACCCCTGCTGATCGAAGAACGGAGAGATTTCTGCATCAGGGTGTCACCTGCTGAAGACCTCCCTTCTGCTCTCAACA

CCAACTTGGGCCACTTCTCAGAGAACCCAATACTCTACTTGCTTCTGCCTCTTATCTTTGTCAACAAGTGTTCATTTGGTTGCAAAGTGGAACTTGAAGT

TTTGAAGGAGCTCCTACAGAGCCCCCAACCCATGCTGTTGGGCCTCTTGGGCCAGTTTCTGGTCATGCCTTTCTATGCTTTCCTGATGGCCAAAGTCTTC

ATGCTACCCAAGGCCTTAGCTCTGGGCCTCATCATTACCTGCTCATCACCTGGTGGTGGAGGGAGCTACCTCTTCAGTCTCCTCCTTGGAGGAGATGTCA

CCCTGGCCATCTCCATGACTTTCATCTCAACAGTAGCTGCCACTGGTTTCCTACCACTCTCATCAGCCATCTACAGCTACCTTCTCAGCATCCATGAAAC

ACTCCACGTGCCCATCTCCAAGATATTGGGGACCCTGCTGTTTATCGCCATCCCCATAGCAGCGGGTGTGGTGATCAAATCTAAGCTCCCCAAGTTCTCT

GAACTACTGTTACAGGTCATCAAGCCCTTCAGCTTTATACTTCTCCTGGGTGGCCTGTTCCTGGCCTACCACATGGGGGTCTTCATCCTAGTGGGAGTCA

GGTTACCCATTGTACTGGTGGGTTTCACAGTGCCTCTTGTTGGCCTCTTGGTGGGCTACAGCCTGGCCATCTGCCTGAAGCTGCCAGTGGCTCAGCGACG

AACAGTCAGCATTGAGGTAGGGGTGCAAAACAGCCTGCTAGCCTTAGCCATGCTACAGCTGTCTCTGCGCCGCCTTCAAGCAGACTATGCCTCTCAGGCC

CCTTTCATTGTGGCACTGAGTGGTACCTCCGAGATGTTGGCTTTGGTTATTGGCCAGTTCATCTATAGCATCTTGTTTCCTGTTCCCTGAGCCCTCTGGA

TCAAGTTTTATAACTTCCAGCCCCCATACTCCTCTCTTCCCACAGTTCTTGTGTACCGTACCAAAGGCCTTTAGTTCTCATGCACTATGCACTCAAGACA

AATCCAGGCTTATTTTTTTACTCCTTTTCGCCCCAGCTTTCAGTGCCAAAGAGGCCATGCTGAGTTAGATAGTTGGGTATTGCCCAGAAATATATTTCAA

TAAAAAAAAACCAAAAAAACAAAA
Translation
 - UNI35131 - MVVKKSRGSSQQLPGLGGQGGCTGFVGMLGTALLFISLPWGAQVMASANISTALGHTSGHYLSIGDGSVTEFDFPEKSEGIIVISS

QYTGQTNGTGPSPILKVISLDTEVLTIKNVSAITWSSGGGFVVGIHSGLAGLAPLHLQLMDFYEAPPLLIEERRDFCIRVSPAEDLPSALNTNLGHFSEN

PILYLLLPLIFVNKCSFGCKVELEVLKELLQSPQPMLLGLLGQFLVMPFYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFI

STVAATGFLPLSSAIYSYLLSIHETLHVPISKILGTLLFIAIPIAAGVVIKSKLPKFSELLLQVIKPFSFILLLGGLFLAYHMGVFILVGVRLPIVLVGF

TVPLVGLLVGYSLAICLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGQFIYSILFPVP
Transcript ENSMUST00000037967
Sequence
GGGACGAGGCCCGGGCAGGACGGGCCTCACTTGCCGGCGTTTGCCGGCCCGGGCCACTACTTGTGAGGAGCTCTGTGGCCGCGGAAGCAAGTGAGAGATT

TCGACCAG - UNI35131 - TTACCTTACTCTGGTTTTCCTGCCTCCCTCTTCATCAGCGAGATTCAAGGCTGGACCAGGGCCCCCAGG - UNI351

31 - GAAAAAATCCTGCTATCAAGGAAGAAAATATAGGACCAGGACCTTCCCATGGACCCTTCTCAGGACATTCCAACAGCACAAGCAAGGGTGTCTCC

CTAAGACACAAGAGGCCTGAAAAAACTATCCTTTGTGAAGTGCCATGGTGGTCAAGAAAAGCAGAGGTAGCTCCCAGCAGTTGCCTGGCCTGGGAGGACA

GGGTGGTTGTACAGGTTTTGTAGGCATGCTTGGAACTGCCCTGCTGTTCATCAGCCTACCATGGGGAGCTCAAGTGATGGCCAGTGCCAACATCAGCACT

GCTCTGGGCCACACAAGTGGTCACTATTTGAGTATTGGGGATGGCTCAGTGACAGAATTTGATTTCCCTGAGAAGAGTGAGGGTATCATTGTGATCTCTA

GCCAATACACTGGACAGACCAATGGGACAGGCCCCAGCCCCATACTTAAGGTTATATCCCTGGACACAGAGGTGCTGACCATTAAGAATGTGAGTGCCAT

AACCTGGAGCAGTGGAGGTGGCTTTGTGGTAGGCATCCACTCAGGTCTAGCTGGGCTGGCCCCACTCCACCTCCAGCTCATGGATTTCTATGAGGCCCCA

CCCCTGCTGATCGAAGAACGGAGAGATTTCTGCATCAGGGTGTCACCTGCTGAAGACCTCCCTTCTGCTCTCAACACCAACTTGGGCCACTTCTCAGAGA

ACCCAATACTCTACTTGCTTCTGCCTCTTATCTTTGTCAACAAGTGTTCATTTGGTTGCAAAGTGGAACTTGAAGTTTTGAAGGAGCTCCTACAGAGCCC

CCAACCCATGCTGTTGGGCCTCTTGGGCCAGTTTCTGGTCATGCCTTTCTATGCTTTCCTGATGGCCAAAGTCTTCATGCTACCCAAGGCCTTAGCTCTG

GGCCTCATCATTACCTGCTCATCACCTGGTGGTGGAGGGAGCTACCTCTTCAGTCTCCTCCTTGGAGGAGATGTCACCCTGGCCATCTCCATGACTTTCA

TCTCAACAGTAGCTGCCACTGGTTTCCTACCACTCTCATCAGCCATCTACAGCTACCTTCTCAGCATCCATGAAACACTCCACGTGCCCATCTCCAAGAT

ATTGGGGACCCTGCTGTTTATCGCCATCCCCATAGCAGCGGGTGTGGTGATCAAATCTAAGCTCCCCAAGTTCTCTGAACTACTGTTACAGGTCATCAAG

CCCTTCAGCTTTATACTTCTCCTGGGTGGCCTGTTCCTGGCCTACCACATGGGGGTCTTCATCCTAGTGGGAGTCAGGTTACCCATTGTACTGGTGGGTT

TCACAGTGCCTCTTGTTGGCCTCTTGGTGGGCTACAGCCTGGCCATCTGCCTGAAGCTGCCAGTGGCTCAGCGACGAACAGTCAGCATTGAGGTAGGGGT

GCAAAACAGCCTGCTAGCCTTAGCCATGCTACAGCTGTCTCTGCGCCGCCTTCAAGCAGACTATGCCTCTCAGGCCCCTTTCATTGTGGCACTGAGTGGT

ACCTCCGAGATGTTGGCTTTGGTTATTGGCCAGTTCATCTATAGCATCTTGTTTCCTGTTCCCTGAGCCCTCTGGATCAAGTTTTATAACTTCCAGCCCC

CATACTCCTCTCTTCCCACAGTTCTTGTGTACCGTACCAAAGGCCTTTAGTTCTCATGCACTATGCACTCAAGACAAATCCAGGCTTATTTTTTTACTCC

TTTTCGCCCCAGCTTTCAGTGCCAAAGAGGCCATGCTGAGTTAGATAGTTGGGTATTGCCCAGAAATATATTTC
Translation
 - UNI35131 -  - UNI35131 - MVVKKSRGSSQQLPGLGGQGGCTGFVGMLGTALLFISLPWGAQVMASANISTALGHTSGHYLSIGDGSVTEF

DFPEKSEGIIVISSQYTGQTNGTGPSPILKVISLDTEVLTIKNVSAITWSSGGGFVVGIHSGLAGLAPLHLQLMDFYEAPPLLIEERRDFCIRVSPAEDL

PSALNTNLGHFSENPILYLLLPLIFVNKCSFGCKVELEVLKELLQSPQPMLLGLLGQFLVMPFYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLL

LGGDVTLAISMTFISTVAATGFLPLSSAIYSYLLSIHETLHVPISKILGTLLFIAIPIAAGVVIKSKLPKFSELLLQVIKPFSFILLLGGLFLAYHMGVF

ILVGVRLPIVLVGFTVPLVGLLVGYSLAICLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGQFIYSILFPV

P

For any suggestions or comments, please send an email to unitrap@crg.es