Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032872 (Cyb5r4)
Chromosomal location
Chr 9: 86916864 - 86972282 (+)
Description
cytochrome b5 reductase 4 Gene [Source:MGI Symbol;Acc:MGI:2386848]
RefSeq_dna
NM_024195 
RefSeq_peptide
NP_077157.2 
UniGene
Mm.394780 
MGI
MGI:2386848 
Uniprot/SWISSPROT
Q3TDX8 
Uniprot/SPTREMBL
Q9CV68 
Human Ortholog
ENSG00000065615 (CYB5R4)
Omim not available
UniTrap UNI3993
Vector Insertion
Chr 9: 86924440 - 86927214
Public Clones AR0343 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1261
Vector Insertion
Chr 9: 86927297 - 86933560
Public Clones DD0645 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29147
Vector Insertion
Chr 9: 86936146 - 86937614
Public Clones not available
Private Clones OST7366 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113151
Sequence
ATGGATTGGATCCGACTGACCAAGAGTGGAAAGGACTTAACAGGATTGAAGGGCGGGTTAATTGAAGTAACTGAAGAAGAGCTTAAGAAGCACAACAAGA

AAGAAGATTGTTGGATATGCATAAGAG GGTTTGTTTACAACGTCAGCCCTTATATGGAGTACCATCCGGGTGGGGAGGATGAACTCATGAGAGCCGCAG

GAGCCGATGGAACAGATCTTTTTAATGAG - UNI3993 - GTTCATCGTTGGGTCAATTATGAATCCATGCTGAAAGAATGCCTGGTTGGCAGGATGG

CTGTGAAGCCTGCTGTTCCAAAAG - UNI1261 - ACTGTCATGAAGGAAAGAGAGTCTTAAATG GCATGCTTCCCAAGAGCCAAATGTCAGACACA

CTGCCCAGGGATGTGACAGACACACTGCCCAGGGAAGACCTCAGTTCTCCAAG CTATGATTGGTTCCAAACAGAGTCTTCAGTCACCATTGTTGTATAC

ACCAAACAAAAG - UNI29147 - AATATCAGTTTAGACTCAGTAATCGTTGACCTCCAGGATGACTCCTTGAGAGCAGAAGCAGTCATCAAGGATCA

CTCTTACCTTGTACATGTTG GGCTAAGCCATGAAGTTCAAGAAAATTTTTCTG TACGGGTTATTGAAAATGTTGGAAAAATAGAGATTGTCCTACAAA

AGAAAGAAAGTGTTTCTTGGCAATGTCTTGGTGATCACCTGGAGAAACATGATTCTTTCATTCCAAAGAAAGATACAG GCTTGTACTACAGACGGTGCC

AGTTAATATCTAAGGAAGATGTCACTCATGACACGAGACTTTTCTGTCTGATGCTGCCTCCAAGTACTCACCTTCAGGTGCCAGTTGGACAACATGTTTA

CCTCAAGCTCAGTGTCACAG GTGCAGAAATAGTAAAGCCATATACACCCGTGTCTGATTCCTTACTCTCAGATTTTAAAGAACCAGTCCTTTCCCCAAA

TAAATACATCTGCTTTTTGATCAAAATCTATCCTGCTGGACTCTTCACACCAGAGCTTGATCGTCTTCAGATTG GAGATTTTATTTCTGTAAGCGGACC

TGAAGGCGATTTTAAAGTATCCAAACTCCAGGAAGTAGAAGATCTCTTTCTATTGGCAGCCGGAACAGGATTCACACCAATGGTCACTGTACTGAATTAT

GCTTTGTCTCACATGTCCAGTCTCAG GAAGGTGAAGTTGATGTTCTTCAATAAAACAGAGGACGATATAATTTGGAGATGTCAGCTAGAGAAGTTGGCA

TTAAGAGAAAAAAG ATTTGATGTTGAATTTGTTCTCTCGGCACCTTCTCCAGAATGGAATGGCAAACAGGGACACATATCACGAGCTCTTCTCTCTGAA

TTTTTGCAAAGAAGTTCAGAAAACTCTAGGGCCTTCCTTTGCATCTGCGGACCAACACCATTTACTGACGAGGGGATAAG GTTGCTGCATGATCTTAAC

TTTTCTGATGATGAGATTCACGGATTCACCGCTTAA
Translation
MDWIRLTKSGKDLTGLKGGLIEVTEEELKKHNKKEDCWICIRG GFVYNVSPYMEYHPGGEDELMRAAGADGTDLFNE - UNI3993 - VHRWVNYES

MLKECLVGRMAVKPAVPKD - UNI1261 - DCHEGKRVLNG GMLPKSQMSDTLPRDVTDTLPREDLSSPS SYDWFQTESSVTIVVYTKQK - UNI

29147 - NISLDSVIVDLQDDSLRAEAVIKDHSYLVHVG GLSHEVQENFSV VRVIENVGKIEIVLQKKESVSWQCLGDHLEKHDSFIPKKDTG GLY

YRRCQLISKEDVTHDTRLFCLMLPPSTHLQVPVGQHVYLKLSVTG GAEIVKPYTPVSDSLLSDFKEPVLSPNKYICFLIKIYPAGLFTPELDRLQIG G

DFISVSGPEGDFKVSKLQEVEDLFLLAAGTGFTPMVTVLNYALSHMSSLR RKVKLMFFNKTEDDIIWRCQLEKLALREKR RFDVEFVLSAPSPEWNGK

QGHISRALLSEFLQRSSENSRAFLCICGPTPFTDEGIR RLLHDLNFSDDEIHGFTA
Transcript ENSMUST00000050631
Sequence
CGCCTGACCCCTGGCGACCCCGGAAGTGGGTCGGGGGCTTGGCCTCGGCCGGGCCAAGGAGCCCGCACGGACGGTGGTGGGCGCTGGGGTCCCACCAGGG

CAGCCTGTCCGGTGGCGGAGCCCGGATGCGGCCCGAGCCGGGGGCCCAGGATGCTGAACGTCCCTTCCCAGGCTTTCCCGGCCCCCGGCTCCCAGCAGCG

CGTCTCCTCCCAGGGGCGCAGCAAG GTACCTTTAAAACAAGGCAGGAGTCTTATGGATTGGATCCGACTGACCAAGAGTGGAAAGGACTTAACAGGATT

GAAGGGCGGGTTAATTGAAGTAACTGAAGAAGAGCTTAAGAAGCACAACAAGAAAGAAGATTGTTGGATATGCATAAGAG GGTTTGTTTACAACGTCAG

CCCTTATATGGAGTACCATCCGGGTGGGGAGGATGAACTCATGAGAGCCGCAGGAGCCGATGGAACAGATCTTTTTAATGAG - UNI3993 - GTTCA

TCGTTGGGTCAATTATGAATCCATGCTGAAAGAATGCCTGGTTGGCAGGATGGCTGTGAAGCCTGCTGTTCCAAAAG - UNI1261 - ACTGTCATGA

AGGAAAGAGAGTCTTAAATG GCATGCTTCCCAAGAGCCAAATGTCAGACACACTGCCCAGGGATGTGACAGACACACTGCCCAG TGATAGCAGTTCTG

CACAACCCCACAAAC CTTTGATTACTTACAGCTATGATTGGTTCCAAACAGAGTCTTCAGTCACCATTGTTGTATACACCAAACAAAAG - UNI2914

7 - AATATCAGTTTAGACTCAGTAATCGTTGACCTCCAGGATGACTCCTTGAGAGCAGAAGCAGTCATCAAGGATCACTCTTACCTTGTACATGTTG G

GCTAAGCCATGAAGTTCAAGAAAATTTTTCTG TACGGGTTATTGAAAATGTTGGAAAAATAGAGATTGTCCTACAAAAGAAAGAAAGTGTTTCTTGGCA

ATGTCTTGGTGATCACCTGGAGAAACATGATTCTTTCATTCCAAAGAAAGATACAG GCTTGTACTACAGACGGTGCCAGTTAATATCTAAGGAAGATGT

CACTCATGACACGAGACTTTTCTGTCTGATGCTGCCTCCAAGTACTCACCTTCAGGTGCCAGTTGGACAACATGTTTACCTCAAGCTCAGTGTCACAG G

TGCAGAAATAGTAAAGCCATATACACCCGTGTCTGATTCCTTACTCTCAGATTTTAAAGAACCAGTCCTTTCCCCAAATAAATACATCTGCTTTTTGATC

AAAATCTATCCTGCTGGACTCTTCACACCAGAGCTTGATCGTCTTCAGATTG GAGATTTTATTTCTGTAAGCGGACCTGAAGGCGATTTTAAAGTATCC

AAACTCCAGGAAGTAGAAGATCTCTTTCTATTGGCAGCCGGAACAGGATTCACACCAATGGTCACTGTACTGAATTATGCTTTGTCTCACATGTCCAGTC

TCAG GAAGGTGAAGTTGATGTTCTTCAATAAAACAGAGGACGATATAATTTGGAGATGTCAGCTAGAGAAGTTGGCATTAAGAGAAAAAAG ATTTGAT

GTTGAATTTGTTCTCTCGGCACCTTCTCCAGAATGGAATGGCAAACAGGGACACATATCACGAGCTCTTCTCTCTGAATTTTTGCAAAGAAGTTCAGAAA

ACTCTAGGGCCTTCCTTTGCATCTGCGGACCAACACCATTTACTGACGAGGGGATAAG GTTGCTGCATGATCTTAACTTTTCTGATGATGAGATTCACG

GATTCACCGCTTAAGAAAAAGCTGCCATTGTCTTTTATTCAACTAGTTTATATTTGTGATTGCCTAGGAGTTTTTAAATGAGTTTTTGTATGTATGGAAG

GCTTTGCTTTCTGAAATGAAATCATGTGTCTTCAGTACAAGTAACTTCTTGGTTTAATTTTGTACCGTGACTTATCTTACTGCTGACCCTGACCTGGAGG

GTCAGTCATGGCAGCAGGTGCATATGGGAGCCTTTGTTATGAACTGCAAGTTTCCTGACCACTGAAGTTGTATCACTGTTCGGCAGTCAACACTTGTATT

TTATGACATGATAAACTAAGCAATCATTTTGGTTACTTTTTATGCTGCAAGATATCTTCTGAGCAATATGTATTAAATATTCCACTGCACTGTTCACTCA

GGAATTGATGGTGTATGTCCTTAGTAGTCTTAAAACTTGGAATGCTGTAACTATTGGTGGTCCAGTTTTGTGAACTGGACAGATAGAATAAAACTATACT

TCCATACTTTTTACTCCCTGTGGTGGACGTGTGGCTGAAGGTAACAAATACAGTGGTTGTCTTAAAGGGAGTTTTATTT
Translation
MLNVPSQAFPAPGSQQRVSSQGRSK VPLKQGRSLMDWIRLTKSGKDLTGLKGGLIEVTEEELKKHNKKEDCWICIRG GFVYNVSPYMEYHPGGEDELM

RAAGADGTDLFNE - UNI3993 - VHRWVNYESMLKECLVGRMAVKPAVPKD - UNI1261 - DCHEGKRVLNG GMLPKSQMSDTLPRDVTDTLP

S SDSSSAQPHKP PLITYSYDWFQTESSVTIVVYTKQK - UNI29147 - NISLDSVIVDLQDDSLRAEAVIKDHSYLVHVG GLSHEVQENFSV V

RVIENVGKIEIVLQKKESVSWQCLGDHLEKHDSFIPKKDTG GLYYRRCQLISKEDVTHDTRLFCLMLPPSTHLQVPVGQHVYLKLSVTG GAEIVKPYT

PVSDSLLSDFKEPVLSPNKYICFLIKIYPAGLFTPELDRLQIG GDFISVSGPEGDFKVSKLQEVEDLFLLAAGTGFTPMVTVLNYALSHMSSLR RKVK

LMFFNKTEDDIIWRCQLEKLALREKR RFDVEFVLSAPSPEWNGKQGHISRALLSEFLQRSSENSRAFLCICGPTPFTDEGIR RLLHDLNFSDDEIHGF

TA

For any suggestions or comments, please send an email to unitrap@crg.es