Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032898 (Fbxo21)
Chromosomal location
Chr 5: 118426801 - 118460199 (+)
Description
F-box protein 21 Gene [Source:MGI Symbol;Acc:MGI:1924223]
RefSeq_dna
NM_145564 
RefSeq_peptide
NP_663539.1 
UniGene
Mm.21912 
MGI
MGI:1924223 
Uniprot/SWISSPROT
Q8VDH1 
Human Ortholog
ENSG00000135108 (FBXO21)
Omim not available
UniTrap UNI2471
Vector Insertion
Chr 5: 118428003 - 118429749
Public Clones XT0772 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6562
Vector Insertion
Chr 5: 118452182 - 118458018
Public Clones YHB304 (baygenomics) YHA151 (baygenomics) YHB409 (baygenomics) YHB116 (baygenomics)
YHB417 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035579
Sequence
GCGGACAAGATGGCGTCGGTAGCGGGGGACAGCGCTATGGAGGTGGTGCCGGCGCTGGCCGAGGAGGCCGCGGCTGAGGCGACGGGCCCCAGCTGCCTGG

TGCAGCTGCCGGGCGAGGTGCTGGAGTACATCCTGTGCAGCGGCTCGCTCACGGCGCTGGACATCGGCCGCGTGTCCAGCACCTGCCGCCGCCTGCGCGA

GGTGTGCCAGAGCAGCGGGCAGGTGTGGAAGGAGCAGTTCCGGGTGAG GTGGCCCTCCCTGATGAAGCACTACAGCCCCACCGACTACGTCAATTGGTT

AGAGGAATATAAAGTTCGGCAGAAAGCTGGGTTAGAAGCCCGGAAGATTGTAGCTTCCTTCTCCAAGCGGTTCTTTTCAGAGCAC - UNI2471 - GT

CCCCTGTAATGGCTTCAGTGACATTGAAAACCTTGAGGGCCCAGAGATCTTTTTTGAGGATGAGCTGGTGTGTATCCTAAACATGGAAGGAAG GAAAGC

TTTGACCTGGAAATACTACGCAAAGAAAATTCTCTACTACCTGCGGCAGCAGAAAATCCTCAATAACCTCAAGGCGTTCCTGCAGCAGCCCGACGATTAC

GAGTCCTATCTCGAAG GTGCCGTTTACATCGACCAGTACTGCAACCCACTCTCCGACATCAGCTTCAGAGACATCCAGGCCCAGATCCACAGCATTGTG

GAGCTTGTGTGCAAAACCCTCCGTGGCATCAACAGCCGCCACCCCAGCCTGACCTTCAGGGCAG GTGAGTCCTCTATGATAATGGAGATAGAACTTCAG

AGCCAAGTGCTGGACGCTATCAACTATGTCCTGTATGACCAGCTGAAGTTCAAAGGGAACCGCATGGACTACTATAATGCCTTGAACCTCTACATGCACC

AG GTGTTGACCCGCAGAACAGGAATCCCCATCAGCATGTCTCTGCTCTACCTGACCGTCGCCCGGCAGCTGGGGGTTCCCCTGGAGCCTGTCAACTTCC

CAAGCCACTTCCTGCTGCGGTGGTGCCAAGGTGCAGAAGG GGCAACCCTGGACATCTTTGACTACATCTACATAGATGCTTTTGGGAAGGGCAAGCAGC

TGACAGTGAAAGAGTGTGAGTACCTGATTGGCCAGCACGTGACGGCAGCACTCTACGGCGTGGTGAATGTGAAGAAGGTGCTACAGCGGATGGTGGGCAA

CTTGCTGAGCCTGGGCAAGAG GGAAGGCATTGACCAGTCCTACCAGCTCCTCAGAGACTCCTTGGACCTGTACCTGGCGATGTACCCGGACCAGGTGCA

GCTCCTGCTCCTCCAAGCCAGACTCTACTTCCACCTGGGCATCTGGCCAGAGAAG TCTTTCTGTCTTGTCTTGAAGGTGCTTGACATCCTCCAGCACAT

CCAGACCCTGGACCCCGGGCAGCACGGGGCGGTGGGCTATCTCGTGCAGCATACCTTAGAGCACATTGAGCGTAAGAAGGAGGAGGTGGGCGTGGAGGTG

AAGCTGCGCTCCGAGGAGAAGCACAGGGATGTCTGCTACTCCATCGGGCTTGTGATGAAGCATAAGAG GTACGGCTACAACTGTGTGATCTACGGCTGG

GACCCTACGTGCATGATGGGGCATGAGTGGATCCGAAACATGAATGTGCACAGCCTGCCTCATGGCCACCATCAGCCCTTCTACAACGTCCTGGTGGAGG

ATGGCTCCTGCAGATATGCAGCCCAAG - UNI6562 - AAAACCTGGAATACAACGTGGAGCCTCAGGAAATCTCGCACCCAGATGTGGGGCGCTACT

TCTCGGAGTTCACAGGCACACACTACATCCCAAATGCAGAGCTGGAGATCCGGTACCCCGAGGACCTGGAGTTTGTGTACGAGACAGTGCAGAATATTTA

CAGTGCAAAGGAGGACACAGCCGAGTAAACTCAGGGGGTGTCACATCTGTGCTGCTGCTGCTGCTGCTGCTGCTACCTTCTAGGGGACCAGGATTCCTGA

AGGACGTGTGCTGCCCCTGGAGTCAGCACAGGACAGCCACTTCACCAGCAGCCTGGCTGCCTCCCCACTTTAGATGGTGTGCGCTCCTCCAGCCACAGAC

AGCGTTGCTCTCCGCTACACTAGTGAATCAGTTGAAAGGCACCGTGTCCCGTGGCATGGCTCGTGTGCTTGTCCCGTGGTGACAGTGTGTGACATTCTGT

CCTCTCACCCCCTTCCCATCCCTGTCTCCATCTACCTTGTGTCAGTCTCTCCCGCTGGACAGTCAGTCGGGGCCATATTTCCTCATCTCTGGAACAAGGT

CGCTGAGTCAGGCCTGCCGCCCTCTGCCTTCCGTTAGATTGTACTTGGAGAAGGGCATGGAGGTGGGAGTCAGAATGATCACGGTTCAGGTTTTGCTAAT

ACAGAAACACAGATTTCAAGTATTCCCTTTTTTTGTTGTTGTTATTTTTAATTTAATTTGGGAGAACAGTGTCTCCCTTCTCTCACTGGGTCTGTGCACA

TTTCTGCCTGTTGTGAGCTCCTGTCTTGTTACGTTGGTTCTCTGAGCAAATGCACAGCAATGGCCTTTCCGAGTGAGCTGCTCCTTTAAGATGACTACTC

CTTGGTTAACTTTAAGATCTACTCCAGTATCCTGAGCAGATCTTAAGTCGGTCATGGGCCCGCTTCAGTAGCAAAGCCTGCAGATCAAAGGAAAATGGCT

CTTAAAACTTGTACCTCCTGGTCCCCAAACCAAGAGAACGGGTCTGTTCTTCTGATCAGGAAAATGAACTGATGAAGCCTAACCAGGGGAGACAGGTGTC

ATGTTCCCTGTCACTCCTGAGTCACACATCCAGACCCTCCATTTTGAGAGTGTTGGGCTTACGGGAAGCGGAGCACATGCTCTGGGCTTCAAGCTGCCTG

TCTGAAGGCTCCAGGACGCTGACTCTTGGATGAGGTCTGGCCTCAGGTCACCCTTGGCTTCTGCCTGATGCTGTCTGTGAGTGAGGAGCAAGCCTTTACC

AGATCCTAGTGGGTGCTACCTGGTCCTCAGACAAGCAGTCCCATAAGTAAAACTACCCACTGGGCCAATGGCACATCTGTCCTGTGTTGCTGTAGTGAGC

GGAGCTTTAGGGGGCCGCCTGCCAGCCTTGCCCACCCGCCTGCCTGCCGCATGTGTATCCTCACACCACACCGCTCGCTCCAAATGAGCGCTCCCTCTTC

CATTGCCCTTCACCAGCCCCAGGATGATGGGATGAGGCAGTTACTAGAAGGGCAGGAAGCTTGAAGCTCTTGCAGCTGAAAAGGTTCCTGCCCAGCCTGT

GCCTCACCAGGCAGAACCAGTCAGAGGCGGGTCCAGACTTACATTTGGAAACTTAACTCCTCAGAGCTTCTGCCCGCGGTTGGGGGATTTTACACCTGCT

CATTCAAAGGTGAGAACCGCCCGCCCCACGAGGACTCACACCCTTGCACCCCAGTACTAAGCAGCCTCGGAGCATGGTGGGAGTCTCCATTGCTGGGTTT

CTGCTTCGATTTCCTTTTTCCTGTAGAGAAACGTCAAAGCTGAGAAAGATGGCTTCCCTCCCTGACCTGACTGTAAATAATGTACTTAGACTGTTTTTAA

ATGTGTTTCTTCACGAAGGCTTCGTTTGGCTGAGGGAGCCTATATCACTCGTGTAAGTTGGTATTTGGGCACTTTATATTTTTCTAAAAATGTGTTTTGG

ATCCTGTACTCTAATAAATCATAAGTTTCTTTTTAAAAATTTTTCCAAAAGTTTTCTCCATTTTCAAAAACCCTGTTATAAAAAGTAGAACTTTCACAAT

GTTAAAATACTAAATATTTGGTTATAGCAACTTCTCTTCTAATGAATGCCAAGGGTCTTTTTTTTTTCTTTTCTTTTCTTTTTCTTTTTCTTTTGTACAA

CAATTAATAAACGAACTTGCC
Translation
MASVAGDSAMEVVPALAEEAAAEATGPSCLVQLPGEVLEYILCSGSLTALDIGRVSSTCRRLREVCQSSGQVWKEQFRVR RWPSLMKHYSPTDYVNWLE

EYKVRQKAGLEARKIVASFSKRFFSEH - UNI2471 - VPCNGFSDIENLEGPEIFFEDELVCILNMEGR RKALTWKYYAKKILYYLRQQKILNNLK

AFLQQPDDYESYLEG GAVYIDQYCNPLSDISFRDIQAQIHSIVELVCKTLRGINSRHPSLTFRAG GESSMIMEIELQSQVLDAINYVLYDQLKFKGNR

MDYYNALNLYMHQ VLTRRTGIPISMSLLYLTVARQLGVPLEPVNFPSHFLLRWCQGAEG GATLDIFDYIYIDAFGKGKQLTVKECEYLIGQHVTAALY

GVVNVKKVLQRMVGNLLSLGKR REGIDQSYQLLRDSLDLYLAMYPDQVQLLLLQARLYFHLGIWPEK SFCLVLKVLDILQHIQTLDPGQHGAVGYLVQ

HTLEHIERKKEEVGVEVKLRSEEKHRDVCYSIGLVMKHKR RYGYNCVIYGWDPTCMMGHEWIRNMNVHSLPHGHHQPFYNVLVEDGSCRYAAQE - UN

I6562 - ENLEYNVEPQEISHPDVGRYFSEFTGTHYIPNAELEIRYPEDLEFVYETVQNIYSAKEDTAE

For any suggestions or comments, please send an email to unitrap@crg.es