Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032908 (Sgpp2)
Chromosomal location
Chr 1: 78306920 - 78416862 (+)
Description
sphingosine-1-phosphate phosphotase 2 Gene [Source:MGI Symbol;Acc:MGI:3589109]
RefSeq_dna
NM_001004173 
RefSeq_peptide
NP_001004173.1 
UniGene
Mm.276248 
MGI
MGI:3589109 
Uniprot/SWISSPROT
Q810K3 
Uniprot/SPTREMBL
B2RWL5 
Human Ortholog
ENSG00000163082 (SGPP2)
Omim not available
UniTrap UNI32972
Vector Insertion
Chr 1: 78307078 - 78356645
Public Clones IST12630A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036172
Sequence
CGCGAGGCCAGGGCGCACGCTGAGGACACGGACGCGCGTGGCTGCGGGTCGGAGGAACGGGGTCACGGCTCACCATGGCCGAACTGCTGCGGAGCCTGCG

GGATTCACAGCTCGTGGCGCGCTTCCAGCGCCGCTGCGGGCTCTTCCCAGCGCGGGAG - UNI32972 - GCTTCTGGAGAGGAGCATGTGGTGAAGA

ATTATTTCTACTATTACCTGTTCCGGTTTTCAGCCGCTTTGGGCCAGGAAGTGTTCTACATCACGTTTCTCCCTTTCACCCACTGGAATATCGACCCTAA

TTTGTCCAGAAGATTGGTTGTGATATGGGTT TTGGTGATGTATATTGGCCAGGTGGCCAAGGACATCCTGAAGTGGCCCCGGCCCTCCTTTCCTCCCGT

TGTGAGACTTGAAAAGAGAATTATTGCAGAGTACGGAATGCCATCCACCCACGCCATGGCGGCCACCGCCATCTCCTTCACCCTCCTCATCTCTACCATG

GACCGGTATCAG TACCCTTTCATTTTAGGCCTGATGATGGCTGTGGTGTTCTCTACGCTGGTGTGTCTCAGCAGACTCTACACGGGGATGCACACGGTC

CTG GATATCCTGGGTGGCGTTCTGATCACTGCAGTCCTCATTGCTCTGACCTACCCTGCCTGGACCCTCATCGATTCCCTGGACTCTGCCAGCCCCCTC

TTCCCTGTGTGTGTCATAGTTGTACCGTTCCTCTTGTGCTACAATTACCCTGTGTCTGACTACTACAGCCCGACCAGGGCAGACACCACCACCATCGTGG

CTGCTGGGGCTGGAGTGACCCTGGGATTCTGGATCAACCATTTCTTCCAGCTCGTGTCCAAGCCCACCCCATCTCTTCCTGTCATTCAGAACATCCCACC

CCTTACCACTGACATGCTGGTTTTAGGTCTGACCAAATTTATGGTGGGAATCATGTTGATCCTCTTGGTTCGCCAACTGGTGCAAAAGCTCTCCCTGCAA

GTATTATTCTCATGGTTCAAGGTGGTTACTAGGAACAAGGAGGCCAGGCGAAGACTAGAGATTGAAGTCCCTTACAAGTTTGTTACCTACACATCTGTTG

GCATCTGTGCCACAACCTTTGTGCCAATGTTGCACAGGTTTTTGGGATTGCTCTGAGCCCAAGACAGTTAGGAACTAGTCCGCTAATGCGAGATGCAAAA

TGGAGAACGCTGTCGATTCAGGTAATCTCAATGCCTCCTGTTTAAGGAAACCCTAAGTCATAGTTTTGTTTTGCTGATGTAACATAGATACGGCTGCTGT

GGGATTCACCTGTAAGGACACCAGGCTCAAACCACAGCTGAGCTCTGCAAGATCACCCCTCCCCTTTCTGTTACATGGACTTGGGACACGGTCTTGGGTG

GACAGGAATTGTGGCCCAGTTTGCAATGGTTACAAGCCCCACCAAGCTCCAGAGACCCAGTAGACTTGAGGTACTATGAAGGCAGGATAGTCTTTTCAGT

TACAACCTTGCCTGATGCCGAGTCTCAATCCCCAAACTGGAGTTTGGTCTGGGAGTAAGGGTGGCACCATGGAAAATCTCAACTCATTGGACAGAATGGC

TTCTTGTGCTGTCATCAGACTGGACTGTCCCTGAGTGGGTGGTGAGACCATTCTAAAATAAAGTTTCCTGTGAGGACACTGAAGATAGTAGCAGAGCCAT

GAGGCCACCGGAAGAGCTTGCTTTATTTACCAACTCATCTCCTCCAGGAACTATTAGTGAAGCAAGATGCTGATCTGCCTTGCAGACAGTCCACAGCATC

CAGTGATTCGGTTTCCACACTAGTGTAAGCAACGCACGACGGGCTGCCAGCTCCTCACAGGTGGAAATGAGGACACGCTGCGACTCCTGCCCTCACCTGC

CTCGCCTTCAACACCTTCAGTTGCTTGAGCTTCCACATAAGCCTGGAAGACACTGAATCAGCACAAGAATGGATGAGCTTCGTCCTCTGGAAGCCCTCAC

ACACTGCCTCATCCCTGTGACTTTACCTTTCGTCATTGCTTGGCTACTTTGTATAAATGTCTTCAGTTATTCACCCTCTAGACAAAATCAGGGACTCCCT

CTCAGTCTTCCCACTCCTTCTTACCTCTTTCTTGGCAAGATTTTTCAGTTAAGAACTTTAAGATGTTTAGACCTGAAGAATTTTAGCACAAGAAAAGCTG

CAGCCTATTTGGAGAGAATAAGCGGGTTAACTGTAGCTCCTGTTAGCCCTAGAATGGTCCTCCTTATCTCCTTAGAGCTAAGAAGGTGTGCAGGACACCC

ACAGCAGAGACCTCCTTCCCTGGGCTCAGCACTTCGGAATAAGCACCAGATGCAATGACATCCCGAAGGGTTCGAGTAAGTGGTAGTCATTGGTCATTTG

AGGGATGGTGTCAGTAAGCCAGTGCTTCACTATATGCTCGTACTGGACAAATCACCCTCTGACCCCCAAAAGAGCTAAGGCTCCAACTTTTGCATTCAGT

GTAAACACCAAAGCCAAAATTTTCTCTGATTTTGAGTATGTCCCATGGTCTATGGTTGGAATGATGTTCTTTGGTACTGAATGTAGTGTTTTAATTCCTG

AAGAATAATTCTTGGACTGGGCATGGTTTTAATCCTAGAATCAGAGGCAGGTAGATCTCTGAGTTTAAGGCCAGCCTGGTCTACAGAGTGAGTTTCAGGA

CAGCCAGGGCTACACAGAGAAACCCTGTCTTGAAAAACAAACAAAAAGAATAATTCTTAACAAAATGCCCATTTTTAACTTGACAATTCTTCTCTTCTTC

GTCATAGTTAAGAACAGGAATGCAAAGGCCTAGCACTTGCCAGGTTTTGCTGACAGTATTTCAGCTCCGTGGCTGGGGAGCCTGGAGCCCTGGTTTACAG

GTGTGCTTGCCTAGGCCAGCCTCCAGTTGTGCATGGCTGTTTCTGTTGTTTCTCCCCCAACCCCCAAGCTACCAAACTAGAGCTTGTAATGCTGGCTTAT

ATTCACACAGGTGATTTTAGTTGGTTTGTCTGAAGCCTAATGACAAAAGGCTCAGCTTCTTCTACGTGTATCTGCAACAGAAGGGCTGTATGTATTGTCA

CAGCGGTGGATGTGGTGATTAGGAAGTTTAAGGCCCAACAACATGGAAGTTGACAACTGAGTGAATGCATTCGAGGCTGTGTTTACATAATTTAGATGGA

GGATGAATATATTAGCCACACAACATTAAACAGTGTCCTAAGAATTTGTCATGACTGGTCACTCTTGGATGGACTTGATACAAGAAAAGGGAGGGAGAAA

GTATTCACTGTAGATGCCAAGTTTAGTTTTGGATTCCTACAGTACTGATTTTAAATGCTATGGCTTGATCACATTTTGCCTTTGGTGAGCCTTCTCAATT

CACCAAACTCACTTCTTACAGAGCAGCACCGGCATCCTAGTAAAGTCTCTCTTGGGTCTCTTTTCAAAACACTTTGTCAGTTTCTCTCTGGAGAGAGAGT

GCCCCCTGCTGGCTTAGCTTGTCTTAGTCCAGAGGCCCTCTTGCACTGGGCTGGCCTGGTCACCAGAATGTGTCCCTGTTAAGTCTAGGCCTGTCCTATG

CGGACACCAAAGCTTTTAGCTTCCTCTGGGAATCAGGAAGAATAACACATCCTTTTCTCATCTTGCTACTACTCTGGGCCAAGTCATCAATGTAGAACCG

GCCTTCCAAGCCGCTGTCCATTTTGCTCAGACCTGTACCTTATGCTGGAAAAAGACATAGGCAAGACCCTTAACCTAATACCTTTCATGATAGCCACTAA

AACCACTTGACACTGTGCCTGGTAACTTGGGTTTTCTTGCCGAAATACACAACTCATCTTCCCAGGATAATCACAGCATGTGGTATTTCAGACCACGTGT

TTCAGGTTTCTATTTTGGAAGCTTTCAACTGTCTTGCTTATGCAGTGTATGTAAATTTATTCTTTTTTAAAATAAAATCTTTTTGTTTGAGTATGATTAT

TAAATGCTTTAAAATCT
Translation
MAELLRSLRDSQLVARFQRRCGLFPARE - UNI32972 - ASGEEHVVKNYFYYYLFRFSAALGQEVFYITFLPFTHWNIDPNLSRRLVVIWV LVMY

IGQVAKDILKWPRPSFPPVVRLEKRIIAEYGMPSTHAMAATAISFTLLISTMDRYQ YPFILGLMMAVVFSTLVCLSRLYTGMHTVL DILGGVLITAVL

IALTYPAWTLIDSLDSASPLFPVCVIVVPFLLCYNYPVSDYYSPTRADTTTIVAAGAGVTLGFWINHFFQLVSKPTPSLPVIQNIPPLTTDMLVLGLTKF

MVGIMLILLVRQLVQKLSLQVLFSWFKVVTRNKEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLL

For any suggestions or comments, please send an email to unitrap@crg.es