Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000032946 (Rasgrp2)
Chromosomal location
Chr 19: 6399340 - 6415212 (+)
Description
RAS, guanyl releasing protein 2 Gene [Source:MGI (curated);Acc:Rasgrp2-021]
RefSeq_dna
NM_011242 
RefSeq_peptide
NP_035372.2 
UniGene
Mm.77017 
MGI
MGI:1333849 
Uniprot/SWISSPROT
Q9QUG9 
Human Ortholog
ENSG00000068831 (RASGRP2)
Omim not available
UniTrap UNI22525
Vector Insertion
Chr 19: 6401701 - 6401864
Public Clones not available
Private Clones OST293127 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26317
Vector Insertion
Chr 19: 6402471 - 6402575
Public Clones not available
Private Clones OST125493 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28800
Vector Insertion
Chr 19: 6403431 - 6403634
Public Clones CMHD-GT_423F1-3 (cmhd)
Private Clones OST19783 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19660
Vector Insertion
Chr 19: 6408249 - 6408447
Public Clones not available
Private Clones OST384454 (lexicon) OST315725 (lexicon)
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28336
Vector Insertion
Chr 19: 6408955 - 6413084
Public Clones IST12551H1 (tigm) IST14985G1 (tigm) IST13218D8 (tigm)
Private Clones OST33554 (lexicon)
Severity of mutation (?) Insertion after 77% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29200
Vector Insertion
Chr 19: 6413465 - 6413864
Public Clones not available
Private Clones OST6061 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18969
Vector Insertion
Chr 19: 6414042 - 6414791
Public Clones not available
Private Clones OST408534 (lexicon) OST250064 (lexicon) OST21127 (lexicon) OST15942 (lexicon)
OST13922 (lexicon) OST6461 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28971
Vector Insertion
Chr 19: 6414993 - 6415211
Public Clones not available
Private Clones OST14527 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113469
Sequence
CAGGGGTCCGAATTGAGCACCGTGGGAGGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACTGGCACCGGCAGCCATGACGAGCACTCTGGACCTGGACAAG

GGCTGCACCGTGGAGGAGCTGCTCCGTGGTTGCATCGAAGCGTTTG - UNI22525 - - UNI26317 - CTGGCTTCGAAACTGCTCCACTT - U

NI26317 - CTATCAGCAATCCCGGAAGGACAACTCCAATTCTCTACAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCA

GCCTTCCCAGCAGAGTTCGACTTGAACCCAGAGCTGGCTGAACAGATCAAGGAGCTGAAGGCTCTGTTAGACCAAGAAGGGAACCGCAGGCACAGCAGCC

TCATCGACATCGAGAGTGTGTGCGTGGGGGCGGAGCGCAAGGGGCACTACGCATGCTACACCATATGTGCTTAATAAATGTCTGTTCAATTGAA
Translation
MTSTLDLDKGCTVEELLRGCIEAFA - UNI22525 - - UNI26317 - AGFETAPL - UNI26317 - LSAIPEGQLQFSTDENVSLGQ - UN

I28800 - VLDLSLPSRVRLEPRAG
Transcript ENSMUST00000113467
Sequence
AGGTTTGCATTCTGAAGTAAAGGACTTGG - UNI22525 - GGGTCCGAATTGAGCACCGTGGGAGGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACT

GGCACCGGCAGCCATGACGAGCACTCTGGACCTGGACAAGGGCTGCACCGTGGAGGAGCTGCTCCGTGGTTGCATCGAAGCGTTTG - UNI22525 - 

- UNI26317 - CAATCCCGGAAGGACAACTCCAATTCTCTACAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCAGCCT

TCCCAGCAGAGTTCGACTTGAACCCAGAGCTGGCTGAACAGATCAAGGAGCTGAAGGCTCTGTTAGACCAAGAAGGGAACCGCAGGCACAGCAGCCTCAT

CGACATCGAGAGTGTGTGCGTGGGGGCGGAGCGCAAGGGGCACTACGCATGCTACACCATATGT
Translation
 - UNI22525 - MTSTLDLDKGCTVEELLRGCIEAFA - UNI22525 - - UNI26317 - AIPEGQLQFSTDENVSLGQ - UNI28800 - V

LDLSLPSRVRLEPRAG
Transcript ENSMUST00000113468
Sequence
CTGCTTCAGGGCCCGGCGCGCGCGGGGCGAGAGGGGGAGTCCCCGGTGGAGGAGGCGCGGCGCGGG - UNI22525 - GGGTCCGAATTGAGCACCGT

GGGAGGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACTGGCACCGGCAGCCATGACGAGCACTCTGGACCTGGACAAGGGCTGCACCGTGGAGGAGCTGCT

CCGTGGTTGCATCGAAGCGTTTG - UNI22525 - - UNI26317 - ATGACTCCGGAAAGGTGCGAGATCCACAGCTAGTGCGCATGTTTCTCATG

ATGCACCCCTGGTACATACCTTCCTCTCAGCTGGCTTCGAAACTGCTCCACTT - UNI26317 - CTATCAGCAATCCCGGAAGGACAACTCCAATTC

TCTACAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCAGCCTTCCCAGCAGAGTTCGACTTGAACCCAGAGCTGGCTGA
Translation
 - UNI22525 - MTSTLDLDKGCTVEELLRGCIEAFD - UNI22525 - - UNI26317 - DDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLH

F - UNI26317 - FYQQSRKDNSNSLQMKTCHLVR - UNI28800 - RYWISAFPAEFDLNPELA
Transcript ENSMUST00000113471
Sequence
CCCACTTCTCCCAGGACAGGGGTCCGAATTGAGCACCGTGGGAGGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACTGGCACCGGCAGCCATGACGAGCAC

TCTGGACCTGGACAAGGGCTGCACCGTGGAGGAGCTGCTCCGTGGTTGCATCGAAGCGTTTG - UNI22525 - - UNI26317 - ATGACTCCGGA

AAGGTGCGAGATCCACAGCTAGTGCGCATGTTTCTCATGATGCACCCCTGGTACATACCTTCCTCTCAGCTGGCTTCGAAACTGCTCCACTT - UNI26

317 - CTATCAGCAATCCCGGAAGGACAACTCCAATTCTCTACAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCAGCCT

TCCCAGCAGAGTTCGACTTGAACCCAGAGCTGGCTGAACAGATCAAGGAGCTGAAGGCTCTGTTAGACCAAGAAGGGAACCGCAGGCACAGCAGCCTCAT

CGACATCGAGAGTGTGTGCGTGGGGGCGGAGCGCAAGGGGCACTACGCATGCTACACCATATGTGCTTAATAAATGTCTGTTCAATTGAA
Translation
MTSTLDLDKGCTVEELLRGCIEAFD - UNI22525 - - UNI26317 - DDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHF - UNI26317 -

 FYQQSRKDNSNSLQMKTCHLVR - UNI28800 - RYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESVCVGAERKGHYACYTICA
Transcript ENSMUST00000113472
Sequence
CTTAGAGCCACCCGCAGGAGGGGGGCGTTCGAGGCATTCCGGTGCTCGCCTGAAACGTATCTACCAGGCTCTTCCCTGCAAGTCCCCATTTGACAGATGG

GAAAATTGAGGTTCAGAGAGACTAAATGATTCTCAAGGTCACCCAGCAAGGAAGTAACAGTCAGGAGGGAACGACTCTGAGAAGTCCTCGGGAGGATTCC

CTAATGTAGGGGAGTCTGTGTAAGGGCGAGGTCCCTTTCCTTGGGACAAGGTTTTGGCGAGATCCAGGAATGTAAAGAACCCCAGGCTTTGGGGCTGCGA

GCCCTGGAGCCTGGTTGAGGGGGGAGGGGCGGCAGAATGGGTGTGTGCGCAACCAGGGGGTATGTGGATGCGTGTGGGAGTGTACATGCGTGGAGATGCA

CTGTCTTTGCGTGTGTGCACACGTGTTCAGATGTCAGAGCTACTGTGATCGAGAGATCAGAGGCTGAGCTGGTTCAAGTGAACAGAAGGTCTGGGAGGTG

AACTGCATTCAGGTTTGCATTCTGAAGTAAAGGACTTGGGTATGTGTGGCTGAGGATTTTCATTGCAGGTGTGCATGGGATGTGGGTGCCATTGTGTGTG

ATTAGGACGGGAGGTGTCTATGACCCTGGTGTGTGTGAAAAGGGTCTTCTTGCACTTAATGTAGGTCATTGGCCTTCGGCAAATACCTAGTCTAGAGAAT

AGGTGTTTGTTCCTGCATGGGTGCTTTTATAGTCCCCACTGATGACCAGGATTATTAATGGTGTCATGCAGGCCATGGCGCTAGCGGCCCCTTCTGGGCT

CCCTACTCGGTGCTCTCACGCACAATTTAACTATGCAGCAGGGTGGGTGGGAAGGCGGGAGCCCAGGTTGGGAAGATATATGGCAATTCTGGAAGGGCTA

GGACCGGACTCCTGGGACCTTAGTACTTGTGGGTTGGGAGTCCGCGGTTCCCAGGCTTTGGCTTCCCACTGACATCTCCCAACCGCAGTGGGCTACCCCT

CCCACCCCCCGCCCCAGGAATGTTCTTCTCTCTAGCCCTCCTCCCCAAGGGCAGGCCCCTGGGGGATGCTACGGCCCCGCCTCCCACTCGGGGAGCCCAG

GAGGGGGAGATGTAGGCAGGACTCCTGGGTTCCCTCCTCCCTCCTTCCATCCCAGGGAGAAATTCCTCCGAGGTCCCCTCAGGCACTGGGTTCCCAAAAT

AACCCTGCGGGGGAAGGGAGGCTGTGAAGGGAGGGGAAGCGGGAGGAGTGCAGAGTCAAGCTGTGGGGTGTTGCAGGTGCCTGTGGGGAGCAAATGCAAG

GAGAGGAGGGCCCGCCAGGAGGCTTGGGGCACTAACTAACCCCTGGGGTCCTGGCTCGTCCCTTATTCTCGTAGAACCCTTCTAACCTCCCGCGACTCCG

CGGGTGGGCCGGAAGCCTCTCAGCTAGTCCATTTCCCAACTAGCGAGTTGCACCATCCCGGGGCAGGACCGTTTAACCCTAGAGGGGCAACGGCAGGCAA

CTCCGCCCATGCCCAGCAGGGGGCGTGCCCACTCCGCCCCGTTCCTACGCGCCGAGCCGCTCCCCCCACCTCCCGCGCCTCTGCTGACTCCCACTTCTCC

CAGGACAGGGGTCCGAATTGAGCACCGTGGGAGGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACTGGCACCGGCAGCCATGACGAGCACTCTGGACCTGG

ACAAGGGCTGCACCGTGGAGGAGCTGCTCCGTGGTTGCATCGAAGCGTTTG - UNI22525 - - UNI26317 - ATGACTCCGGAAAGGTGCGAGA

TCCACAGCTAGTGCGCATGTTTCTCATGATGCACCCCTGGTACATACCTTCCTCTCAGCTGGCTTCGAAACTGCTCCACTT - UNI26317 - CTATC

AGCAATCCCGGAAGGACAACTCCAATTCTCTACAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCAGCCTTCCCAGCAGAG

TTCGACTTGAACCCAGAGCTGGCTGAACAGATCAAGGAGCTGAAGGCTCTGTTAGACCAAGAAGGGAACCGCAGGCACAGCAGCCTCATCGACATCGAGA

GTGTGTGCGTGGGGGCGGAGCGCAAGGGGCACTACGCATGCTACACCATATGTGCTTAATAAATGTCTGTTCAATTGAA
Translation
MTSTLDLDKGCTVEELLRGCIEAFD - UNI22525 - - UNI26317 - DDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHF - UNI26317 -

 FYQQSRKDNSNSLQMKTCHLVR - UNI28800 - RYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESVCVGAERKGHYACYTICA
Transcript ENSMUST00000113475
Sequence
CCGGGCCTCCGCCGCCCGCAGGAAGACGCCCGGGCCCGGGCAGGGTGAACCCCGTGGGAACG - UNI22525 - GGGTCCGAATTGAGCACCGTGGGA

GGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACTGGCACCGGCAGCCATGACGAGCACTCTGGACCTGGACAAGGGCTGCACCGTGGAGGAGCTGCTCCGT

GGTTGCATCGAAGCGTTTG - UNI22525 - - UNI26317 - ATGACTCCGGAAAGGTGCGAGATCCACAGCTAGTGCGCATGTTTCTCATGATGC

ACCCCTGGTACATACCTTCCTCTCAGCTGGCTTCGAAACTGCTCCACTT - UNI26317 - CTATCAGCAATCCCGGAAGGACAACTCCAATTCTCTA

CAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCAGCCTTCCCAGCAGAGTTCGACTTGAACCCAGAGCTGGCTGAACAGAT

CAAGGAGCTGAAGGCTCTGTTAGACCAAGAAGGGAACCGCAGGCACAGCAGCCTCATCGACATCGAGAGTGTGTGCGTGGGGGCGGAGCGCAAGGGGCAC

TACGCATGCTACACCATATGTGCTTAATAAATGTCTGTTCAA
Translation
 - UNI22525 - MTSTLDLDKGCTVEELLRGCIEAFD - UNI22525 - - UNI26317 - DDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLH

F - UNI26317 - FYQQSRKDNSNSLQMKTCHLVR - UNI28800 - RYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESVCVGA

ERKGHYACYTICA
Transcript ENSMUST00000113476
Sequence
TTCATTCCTGGCTTTTTGAGGCTCCACTGGACCAAAACCAGCTCGCATTCTGTCCCAGCCCCTCCCCCAGGCCATCGCAAGGATCCGCAGCCCCACGCCC

GCGACCTCCACCACGCCCGGGCCTCCGCCGCCCGCAGGAAGACGCCCGGGCCCGGGCAGGGTGAACCCCGTGGGAACG - UNI22525 - GGGTCCGA

ATTGAGCACCGTGGGAGGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACTGGCACCGGCAGCCATGACGAGCACTCTGGACCTGGACAAGGGCTGCACCGT

GGAGGAGCTGCTCCGTGGTTGCATCGAAGCGTTTG - UNI22525 - - UNI26317 - ATGACTCCGGAAAGGTGCGAGATCCACAGCTAGTGCGC

ATGTTTCTCATGATGCACCCCTGGTACATACCTTCCTCTCAGCTGGCTTCGAAACTGCTCCACTT - UNI26317 - CTATCAGCAATCCCGGAAGGA

CAACTCCAATTCTCTACAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCAGCCTTCCCAGCAGAGTTCGACTTGAACCCAG

AGCTGGCTGAACAGATCAAGGAGCTGAAGGCTCTGTTAGACCAAGAAGGGAACCGCAGGCACAGCAGCCTCATCGACATCGAGAGTGT - UNI28800 

- CCCTACCTACAAATGGAAGCGGCAGGTGACCCAGCGGAACCCTGTGGAACAGAAAAAGCGCAAGATGTCCTTGTTGTTTGATCACTTGGAGCCTATGG

AGCTGGCAGAACATCTTACCTACCTGGAGTATCGTTCCTTCTGCAAGATCCTG TTCCAAGACTACCACAGCTTTGTGACTCATGGCTGCACCGTAGACA

ACCCGGTCCTGGAGCGATTCATCTCCCTCTTCAACAGTGTCTCTCAGTGGGTCCAACTCATGATCCTCAGCAAGCCCACAGCCACGCAGCGGGCGCTGGT

CATCACGCACTTCGTGCATGTGGCAGAG AGGCTGCTGCAGCTGCAGAACTTCAACACGCTGATGGCCGTCGTGGGAGGCCTGAGCCACAGCTCCATCTC

ACGCCTCAAGGAGACCCACAGCCACGTCAGCCCTGACACCATCAAG CTCTGGGAAGGTCTGACAGAACTAGTGACAGCTACTGGCAACTACAGCAACTA

CCGGCGCAGGCTGGCAGCCTGCGTGGGCTTCCGCTTTCCTATCCTGGGAGTGCACCTCAAGGATCTAGTGGCTCTGCAGCTGGCTCTGCCTGACTGGCTG

GACCCAGGTCGGACCCGGCTCAATGGAGCCAAGATGAGGCAGCTTTTCTGCATTCTGGAGGAGTTGGCCATGGTGACCAGCCTTCGCCCACCCGTACAAG

CCAACCCCGACCTGCTGAGCCTGCTCACG GTGTCCCTGGATCAGTATCAGACAGAGGATGAGCTGTACCAGCTCTCACTGCAGCGAGAGCCACGCTCCA

AGTCGTCG - UNI19660 - CCAACCAGCCCCACCAGCTGCACCCCGCCTCCCCGGCCCCCTGTGTTGGAAGAGTGGACCTCAGTTGCCAAGCCTAAG

CTGGACCAAGCCTTGGTGGCAGAGCACATTGAGAAGATGGTGGAG TCTGTGTTCCGGAACTTTGACGTGGATGGGGACGGTCACATCTCCCAGGAGGAG

TTTCAGATCATCCGGGGCAACTTCCCTTATCTCAGCGCCTTTGGGGACCTGGACCAGAACCA - UNI28336 - GGATGGCTGCATCAGCCGGGAGGA

GATGATTTCCTACTTCCTGCGCTCCAGCTCCGTGCTGGGAGGCCGCATGGGCTTCGTACACAACTTCCAGGAGAGTAACTCGCTACGCCCGGTTGCCTGT

CGCCACTGCAAAGCTCTG ATCCTGGGCATCTACAAGCAGGGCCTTAAATGTAGAG - UNI29200 - CTTGTGGTGTGAACTGCCACAAGCAATGCA

AAGAGCGCCTGTCAGTGGAATGTCGCCGCAGGGCCCAGAGTGTCAGCCTGGAGGGCTCTGCACCCTCTCCCTCACCCACACATACCCACCATCGGGCCTT

CAGCTTTTCCCTGCCTCGCCCAGGCAGGCGCAGCTCTCGGCCTCCAG - UNI18969 - AGATCCGTGAAGAGGAGGTGCAGTCGGTGGAGGACGGAG

TGTTTGACATCCACTTATAAAATG - UNI28971 - CTGTGACTATCAAGGACTCATTCCTGCCTCGGAGGAAAGACTTAGAGTAGAGAAGGGAGCCA

GAGATTCTGGGGCAGGAGGTTGGGGCTGGGGGTGGTGGGGGTCGAGGGTGGCATGCATTGAGAAGAGGGCCAGGGCTGGTGTCCCTAAGGTTGTACAGAC

TCCTGTGAATATTTGTATTTTCCAGATGGAATAAAAAGGCCCGAATAATTAACCT
Translation
 - UNI22525 - MTSTLDLDKGCTVEELLRGCIEAFD - UNI22525 - - UNI26317 - DDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLH

F - UNI26317 - FYQQSRKDNSNSLQMKTCHLVR - UNI28800 - RYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESV - U

NI28800 - VPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKIL FQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMIL

SKPTATQRALVITHFVHVAE RLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPDTIK LWEGLTELVTATGNYSNYRRRLAACVGFRFPILGVHLKD

LVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSLRPPVQANPDLLSLLT VSLDQYQTEDELYQLSLQREPRSKSS - UNI19660 - PTSP

TSCTPPPRPPVLEEWTSVAKPKLDQALVAEHIEKMVE SVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQ - UNI28336 - QDGCISREE

MISYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKAL ILGIYKQGLKCRA - UNI29200 - ACGVNCHKQCKERLSVECRRRAQSVSLEGSAPS

PSPTHTHHRAFSFSLPRPGRRSSRPPE - UNI18969 - EIREEEVQSVEDGVFDIHL - UNI28971 - 
Transcript ENSMUST00000035716
Sequence
CGAGAGATCAGAGGCTGAGCTGGTTCAAGTGAACAGAAGGTCTGGGAGGTGAACTGCATTCAGGTTTGCATTCTGAAGTAAAGGACTTGG - UNI2252

5 - GACAGGGGTCCGAATTGAGCACCGTGGGAGGCTCTGAGAGTGTAGCTTGGGTCTAGCCTACTGGCACCGGCAGCCATGACGAGCACTCTGGACCTG

GACAAGGGCTGCACCGTGGAGGAGCTGCTCCGTGGTTGCATCGAAGCGTTTG - UNI22525 - - UNI26317 - ATGACTCCGGAAAGGTGCGAG

ATCCACAGCTAGTGCGCATGTTTCTCATGATGCACCCCTGGTACATACCTTCCTCTCAGCTGGCTTCGAAACTGCTCCACTT - UNI26317 - CTAT

CAGCAATCCCGGAAGGACAACTCCAATTCTCTACAGATGAAAACGTGTCACTTGGTCAG - UNI28800 - GTACTGGATCTCAGCCTTCCCAGCAGA

GTTCGACTTGAACCCAGAGCTGGCTGAACAGATCAAGGAGCTGAAGGCTCTGTTAGACCAAGAAGGGAACCGCAGGCACAGCAGCCTCATCGACATCGAG

AGTGT - UNI28800 - CCCTACCTACAAATGGAAGCGGCAGGTGACCCAGCGGAACCCTGTGGAACAGAAAAAGCGCAAGATGTCCTTGTTGTTTGA

TCACTTGGAGCCTATGGAGCTGGCAGAACATCTTACCTACCTGGAGTATCGTTCCTTCTGCAAGATCCTG TTCCAAGACTACCACAGCTTTGTGACTCA

TGGCTGCACCGTAGACAACCCGGTCCTGGAGCGATTCATCTCCCTCTTCAACAGTGTCTCTCAGTGGGTCCAACTCATGATCCTCAGCAAGCCCACAGCC

ACGCAGCGGGCGCTGGTCATCACGCACTTCGTGCATGTGGCAGAG AGGCTGCTGCAGCTGCAGAACTTCAACACGCTGATGGCCGTCGTGGGAGGCCTG

AGCCACAGCTCCATCTCACGCCTCAAGGAGACCCACAGCCACGTCAGCCCTGACACCATCAAG CTCTGGGAAGGTCTGACAGAACTAGTGACAGCTACT

GGCAACTACAGCAACTACCGGCGCAGGCTGGCAGCCTGCGTGGGCTTCCGCTTTCCTATCCTGGGAGTGCACCTCAAGGATCTAGTGGCTCTGCAGCTGG

CTCTGCCTGACTGGCTGGACCCAGGTCGGACCCGGCTCAATGGAGCCAAGATGAGGCAGCTTTTCTGCATTCTGGAGGAGTTGGCCATGGTGACCAGCCT

TCGCCCACCCGTACAAGCCAACCCCGACCTGCTGAGCCTGCTCACG GTGTCCCTGGATCAGTATCAGACAGAGGATGAGCTGTACCAGCTCTCACTGCA

GCGAGAGCCACGCTCCAAGTCGTCG - UNI19660 - CCAACCAGCCCCACCAGCTGCACCCCGCCTCCCCGGCCCCCTGTGTTGGAAGAGTGGACCT

CAGTTGCCAAGCCTAAGCTGGACCAAGCCTTGGTGGCAGAGCACATTGAGAAGATGGTGGAG TCTGTGTTCCGGAACTTTGACGTGGATGGGGACGGTC

ACATCTCCCAGGAGGAGTTTCAGATCATCCGGGGCAACTTCCCTTATCTCAGCGCCTTTGGGGACCTGGACCAGAACCA - UNI28336 - GGATGGC

TGCATCAGCCGGGAGGAGATGATTTCCTACTTCCTGCGCTCCAGCTCCGTGCTGGGAGGCCGCATGGGCTTCGTACACAACTTCCAGGAGAGTAACTCGC

TACGCCCGGTTGCCTGTCGCCACTGCAAAGCTCTG ATCCTGGGCATCTACAAGCAGGGCCTTAAATGTAGAG - UNI29200 - CTTGTGGTGTGAA

CTGCCACAAGCAATGCAAAGAGCGCCTGTCAGTGGAATGTCGCCGCAGGGCCCAGAGTGTCAGCCTGGAGGGCTCTGCACCCTCTCCCTCACCCACACAT

ACCCACCATCGGGCCTTCAGCTTTTCCCTGCCTCGCCCAGGCAGGCGCAGCTCTCGGCCTCCAG - UNI18969 - AGATCCGTGAAGAGGAGGTGCA

GTCGGTGGAGGACGGAGTGTTTGACATCCACTTATAAAATG - UNI28971 - CTGTGACTATCAAGGACTCATTCCTGCCTCGGAGGAAAGACTTAG

AGTAGAGAAGGGAGCCAGAGATTCTGGGGCAGGAGGTTGGGGCTGGGGGTGGTGGGGGTCGAGGGTGGCATGCATTGAGAAGAGGGCCAGGGCTGGTGTC

CCTAAGGTTGTACAGACTCCTGTGAATATTTGTATTTTCCAGATGGAATAAAAAGGCCCGAATAATTAACCTGG
Translation
 - UNI22525 - MTSTLDLDKGCTVEELLRGCIEAFD - UNI22525 - - UNI26317 - DDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLH

F - UNI26317 - FYQQSRKDNSNSLQMKTCHLVR - UNI28800 - RYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLIDIESV - U

NI28800 - VPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKIL FQDYHSFVTHGCTVDNPVLERFISLFNSVSQWVQLMIL

SKPTATQRALVITHFVHVAE RLLQLQNFNTLMAVVGGLSHSSISRLKETHSHVSPDTIK LWEGLTELVTATGNYSNYRRRLAACVGFRFPILGVHLKD

LVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSLRPPVQANPDLLSLLT VSLDQYQTEDELYQLSLQREPRSKSS - UNI19660 - PTSP

TSCTPPPRPPVLEEWTSVAKPKLDQALVAEHIEKMVE SVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQ - UNI28336 - QDGCISREE

MISYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKAL ILGIYKQGLKCRA - UNI29200 - ACGVNCHKQCKERLSVECRRRAQSVSLEGSAPS

PSPTHTHHRAFSFSLPRPGRRSSRPPE - UNI18969 - EIREEEVQSVEDGVFDIHL - UNI28971 - 

For any suggestions or comments, please send an email to unitrap@crg.es