Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033068 (Entpd6)
Chromosomal location
Chr 2: 150574885 - 150597409 (+)
Description
ectonucleoside triphosphate diphosphohydrolase 6 Gene [Source:MGI (curated);Acc:Entpd6-001]
RefSeq_dna
NM_172117 
RefSeq_peptide
NP_742115.2 
MGI
MGI:1202295 
Uniprot/SPTREMBL
Q3U0P5 Q8CHZ3 
Human Ortholog
ENSG00000197586 (ENTPD6)
Omim not available
UniTrap UNI10405
Vector Insertion
Chr 2: 150574970 - 150578745
Public Clones D072E04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000094467
Sequence
GGAGAGCTGGGCGCGCGGTGTGTGGTCGCTGTCTGCCTCCGGCTACGCCACTACCTCTCCTGCGGGGCCGAGGGAGCCGTGCAGG - UNI10405 - C

AGCGGCTGCGTAGTTCCCAGCAGACTGAGAAATGAGAAAAATACCAAACCATGGGACCCTGCGGATGACGAAGGTGGCATATCCCCTGGGACTGTGCGTG

GGCCTGTTCATCTATGTTGCCTATATCAAGTGGCACCGGGCCTCTGCTGCCCAGGCCTTCTTCACCATTGCTGGGGCTGCCTCGGGGGCACGGTGGACCC

AGCAGGCCTTCAGCTCCCCAGGCTCAGCTGCACGTGGTCATGAGGTCTTCTATGGGATCATGTTTGACGCTGGGAGCACCGGCACCCGCATCCACGTCTT

CCAGTTCGCCCGGCCACCTGGAG AAACTCCCACCTTGACCCATGAAACCTTCAAAGCACTGAAGCCTGGGCTTTCTGCTTACGCTGATGATGTTGAAAA

G AGTGCTCAGGGGATCCAGGAGCTTCTGAATGTTGCTAAGCAACACATTCCTTATGATTTCTGGAAGGCTACCCCTCTGGTTCTCAAGGCCACAGCTGG

TTTGCGCCTGCTGCCAGGAGAAAAGGCTCAGAAGTTGCTGCAAAAG GTGAAGGAGGTGTTCAAGGCATCACCCTTCCTTGTCGGGGATGACTGTGTTTC

CATCATGAACGGCACAGACGAAG GTGTTTCGGCCTGGATCACTGTCAACTTCCTGACAG GCAGTCTGAAGACCCCAGGAAGCAGCAGTGTGGGCATGC

TGGATTTGGGCGGAGGATCCACTCAGATCACTTTCCTCCCACGTGTCGAG GGTACCCTGCAGGCCTCCCCGCCCGGCCACCTGACGGCGCTGCAGATGT

TTAACAGGACTTACAAGCTGTACTCCTACAG CTACCTGGGGCTGGGACTGATGTCGGCACGGCTGGCTATCTTGGGCGGTGTGGAGGGGAAACCTG CT

GAGAATGACAAGGAACTGGTCAGCCCCTGTCTGTCTCCCCGGTTCCGAGGAGAGTGGGAGCATGCGGAGGTCACCTATAGAATTTCAGGACAGAAGGCAG

 TGGGCCTCTATGAGCTGTGTGCCAGTAGAGTATCAGAAGTCCTCCGAAATAAAGTACACAGGACGGAAGAGGCACAGCACGTGGACTTCTATGCGTTTT

CCTACTACTATGACCTTGCAGCCAGCTTTGGTCTTATAG ATGCAGAGAAAGGAGGCAGCCTTGTAGTTGGAGACTTTGAGATAGCAGCCAAGTACG TG

TGCCGCACTCTGGAGACACAGCCGCCGAGCAGCCCCTTTGCCTGCATGGACCTCACCTACATCAGCCTACTGCTCCACGAGTTTGGTTTTCCCGGGGACA

AGGTGCTGAAG CTGGCTCGGAAAATTGACAATGTTGAAACCAGCTGGGCTCTGGGAGCTATTTTTCATTACATCGACTCCCTGAAGAGACAGAAGGTTC

CTGCCTTGTAGCAGCTGAGCCCTAGTCCCTGCCTCAACCAGAATTCCAAGGCTCCCAACTCCATGGACCCCTCTGTCTTGGAAGTGACACCATCCTTGAG

GAGCCTGCATCTGGCTGAGACCCTCTGTGCCTGCAGTGTCATCTGCAGATTTGCCTGGGACATGGCCCATGTACTAGCCCTGCTACACCACACTAGCTGG

GGCAGGGCCAGGGTAGGAATGCTGCTTGGCCTGAGGCCATCTCCCTGCCTTACTTACCTCCAAGTGGGCAGGGAGCCAGGTGGGGCCCAGGGCACATGCA

GCCCTGTTCTTATTCCATCCCTGTGCAGGATTGTGGCTGCTTTTATGTGTTTCTGTGACGTGAGTCTTGTTTTGTCTCCCAGCCCCTGTTCCCTCATGAG

CCAGGCCTCTCTGCCTTCCCAGAGTTGTGGGAGTTGAAGTAACCTGACCTTGCCACAGTGCAACCTCGAGGGGAGCACATCTTGAATGTGGCCATCTCTT

CCTCGGGACAGACATGTGAAATCACCTGGAGATTTGCTGTCCCACCTTTGAATGGTATAGCATTAACTGATGTGGGGACACTGAGTAGGAAGAAGATGGC

CCAGTGCCTCTTTACAGACCCAGCGTGCCGCCTTTGCAGAGAATGTGGGTGTGAGCAGAGCTGTGAGAATGTTCAGGGCCGTTGCTCAAGTACTACCTTG

TGAGCTGTGAGTGCTTTATGTTAAAACTGAGCCCCTCTTCTGGACACAACTATGTCCCAGTGAATGTATTCCTGCTATGAGCCACTTGCAGACCAGTGGG

GCGGATGAGAAAGCTCAGCCCTGAACCATACTACCCCTTACCCCACCCTCCTCACTCGGCTGCAGCTGGCTTCCCCATGGTCCCCTCAGTGAATGTACAG

TTCATAAAATAAGCTGAGCCACCACTGTTCAACTCAAAATAAAGGTTTACAAGGGTT
Translation
 - UNI10405 - MRKIPNHGTLRMTKVAYPLGLCVGLFIYVAYIKWHRASAAQAFFTIAGAASGARWTQQAFSSPGSAARGHEVFYGIMFDAGSTGTR

IHVFQFARPPGE ETPTLTHETFKALKPGLSAYADDVEK SAQGIQELLNVAKQHIPYDFWKATPLVLKATAGLRLLPGEKAQKLLQK VKEVFKASPFL

VGDDCVSIMNGTDEG GVSAWITVNFLTG GSLKTPGSSSVGMLDLGGGSTQITFLPRVE GTLQASPPGHLTALQMFNRTYKLYSYS SYLGLGLMSAR

LAILGGVEGKPA AENDKELVSPCLSPRFRGEWEHAEVTYRISGQKAV VGLYELCASRVSEVLRNKVHRTEEAQHVDFYAFSYYYDLAASFGLID DAE

KGGSLVVGDFEIAAKYV VCRTLETQPPSSPFACMDLTYISLLLHEFGFPGDKVLK LARKIDNVETSWALGAIFHYIDSLKRQKVPAL

For any suggestions or comments, please send an email to unitrap@crg.es