Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033166 (Dis3)
Chromosomal location
Chr 14: 99475853 - 99498959 (-)
Description
DIS3 mitotic control homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1919912]
RefSeq_peptide
NP_082591.2 
UniGene
Mm.403622 
MGI
MGI:1919912 
Uniprot/SWISSPROT
Q9CSH3 
Uniprot/SPTREMBL
Q8R2P7 
Human Ortholog
ENSG00000083520 (DIS3)
Omim not available
UniTrap UNI38176
Vector Insertion
Chr 14: 99497901 - 99498960
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2457
Vector Insertion
Chr 14: 99490712 - 99494391
Public Clones CJ0045 (sanger) AA0173 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36915
Vector Insertion
Chr 14: 99487980 - 99488975
Public Clones 3SE284A06 (ggtc) 5SE284A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1914
Vector Insertion
Chr 14: 99487070 - 99487980
Public Clones AY0051 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28465
Vector Insertion
Chr 14: 99483245 - 99483374
Public Clones not available
Private Clones OST30317 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000068042
Sequence
GCGGGAATGCGCGTGGCCGCGCCTCGGTTTCTTAGCTGACGGCCGGGATCCCACGCCGCGAGGCGAGATGCTCAGGTCCAAGACGTTCTTGAAGAAGACC

CGCGCGGGCGGCGTGGTGAAGATCGTGCGCGAGCACTACCTGCGGGATGACATCGGCTGCGGCGCGCCGGCTTGCTCGGCCTGCGGCGGGGCGCACGCGG

GCCCGGCCCTGGAGCTGCAGCCCCGGGACCAGGCGAGCAGCCTCTGCCCGTGGCCGCACTACCTTCTGCCGGACACCAATGTGCTGCTGCACCAG ATTG

ATGTCCTCGAACACCCGGCCATCAGAAATGTCATTGTGCTACAAACAGTGATGCAAGAAGTGAGAAACCGGAGCGCCCCCATCTACAAGCGAATCAGGGA

TGTGACCAATAACCAGGAAAAGCATTTCTATACCTTCACTAATGAGCACCATAA AGAAACCTACATCGAGCAAGAGCAGGGAGAGAATGCCAATGACAG

GAATGACAGAGCCATCCGAGTCGCAGCGAAGTGGTACAACGAGCACCTGAAGAGGGTGGCAGCAGACAGTCAGCTGCAAGTTATCCTGATAACCAATGAC

AGGAAGAACAAAGAGAAAGCTGTGCAAGAGGGGATACCAGCCTTCACGT GTGAAGAATACGTAAAGAGCCTGACTGCTAACCCTGAACTTATAGACCGT

CTTGCTTACTTGTCCGATGAAATG AATGAAATAGAAAGTGGGAAAATAATATTTTCAGAGCATCTTCCCTTAAGCAAGCTCCAACAAGGCATAAAATCT

GGTTCCTATCTTCAAGGAACATTCAGAGCTAGCAGGGAAAATTATTTGGAGGCTACAGTATGGATTCATGGAGACAAAGAAGAGGAAAAAGAG - UNI2

457 - ATACTTATACAGGGAATTAAGCATCTAAACAGAGCTGTGCATGAAGACATTGTGGCCGTGGAGCTACTGCCCAGGAGCCAGTGGGTGGCACCGT

CTTCCGTGGTTTTAGACGATGAAGGTCAAAATGAAGACGATGTGGAGAAAGATGAGGAGAGAGAACTCCTG CTTAAGACTGCTGTAAGTGAAAAAATGT

TACGGCCTACAGGTCGAGTTGTGGGGATAATAAAAAGGAACTGGAGACCGTATTGTGGCATGCTTTCCAAGTCTGATATTAAGGAG - UNI36915 - 

TCAAGAAGACATCTCTTTACACCCGCTGATAAGAGAATTCCACGAATTCGGATAGAAACCAGACAGGCTTCTGCGTTAGAAGGACGGAGAATTATTGTCG

CTATTGATGGTTGGCCTAGAAATTCTAGATATCCAAAT - UNI36915 - GGACACTTTGTAAAGAATTTAGGCGATGTTGGAGAGAAGGAGACAGAA

ACGGAAGTGTTGCTGCTCGAGCACGATGTTCCTCATCAGCCCTTTTCCCAGGCTGTGCTTAGCTTCCTGCCCAGGATGCCCTGGAGCATTACTGAGGAG 

- UNI1914 - - UNI36915 - GACATGAAAAACCGAGAAGACCTGAGACATCTGTGTGTTTGCAGTGTGGACCCTCCAGGGTGCACTGACATAGAT

GACGCTCTGCATTGTAGAGAGCTCAGCAATGGAAACTTGGAG GTTGGTGTTCATATTGCGGATGTTAGCCATTTTATCAGGCCAGGAAATGCGTTGGAT

CAAGAATCTGCAAGAAGAGGAACAACTGTTTATCTTTGTGAAAAG AGGATTGACATGGTTCCAGAGTTGCTCAGCTCCAACCTCTGTTCCTTAAGATCC

AACGTTGACAG - UNI28465 - GCTTCTCTTACGTACGCGGAAGCACAGATGAGAATTGATTCGGCGGCTATGAATGATGATATTACCACTAGTCTC

CGTGGACTCAATCAGCTGGCTAAAATTCTAAAAAAGGGAAGGATTGAAAAGGG - UNI28465 - GGCTTTGACTCTGTCTTCTCCAGAGATCCGATT

CCACATGGACAGTGAAACCCACGACCCAATCGACCTGCAGACGAAAGAGCTGAG AGAAACAAATTCCATGGTGGAAGAATTTATGTTACTTGCTAATAT

TTCTGTCGCAAAAAAAATTCATGAAGAGTTTTCTGAACATGCTCTGCTTCGGAAACACCCAGCTCCGCCTCCCTCGAATTATGACATTCTTGTTAAGGCT

GCAAAGTCCAAG AATTTGCAAATTAAGACTGATACAGCCAAATCTTTGGCCGACTCTTTGGACCGGGCTGAATCTCCGGATTTCCCATACCTGAATACT

CTATTAAGGATACTGGCCACTCGCTGTATGATGCAAGCTGTGTACTTCTGCTCTGGGATGGATAATGATTTTCATCACTATGGCTTAGCCTCCCCCATAT

ACACACATTTCACCTCTCCTATCAGAAG ATATGCAGACATAATTGTCCATCGGCTATTAGCTGTGGCGATTGGGGCTGACTGTACTTACCCTGAGTTGA

CAGACAAACACAAGCTTTCAGATATATGTAAAAACCTCAATTTCCGGCATAAAATGGCTCAGTATGCCCAGCGTGCTTCGGTGGCTTTTCATACACAG T

TGTTTTTCAAAAGCAAAGGAATAGTAAGTGAAGAAGCCTATATTCTCTTTGTAAGGAAAAATGCAATTGTGGTGTTAATTCCAAAGTATGGCTTAGAAGG

TACAGTTTTCTTTGAAGAAAAAGATAAACCAAAGCCACGCCTTGCTTACGATGATGAG ATCCCTTCCCTGAGAATAGAAGGTACAGTGTTCCATGTGTT

TGATAAGGTTAAAGTGAAGATCACATTAGATTCATCAAATCTTCAACATCAGAAAATCCGCATGGCCCTTGTAGAACCACAG ATCCCAGGAATAAATAT

TCCTCCTAATGTTGCAGACAAGGCTCTTACTGCACCAGGGGGAAAGAAGAGGAAGCTTGAGAAGTAGCTACGTTCAACAGAACATCCAAAGACTCAACAG

CAACAAAATGGAGAGCATACTTACAGACTCCTGTGCGATAGCTACTTTTAAATACATTTCAATAATTTTAACAAATTTG
Translation
MLRSKTFLKKTRAGGVVKIVREHYLRDDIGCGAPACSACGGAHAGPALELQPRDQASSLCPWPHYLLPDTNVLLHQ IDVLEHPAIRNVIVLQTVMQEVR

NRSAPIYKRIRDVTNNQEKHFYTFTNEHHK KETYIEQEQGENANDRNDRAIRVAAKWYNEHLKRVAADSQLQVILITNDRKNKEKAVQEGIPAFTC CE

EYVKSLTANPELIDRLAYLSDEM NEIESGKIIFSEHLPLSKLQQGIKSGSYLQGTFRASRENYLEATVWIHGDKEEEKE - UNI2457 - ILIQGIK

HLNRAVHEDIVAVELLPRSQWVAPSSVVLDDEGQNEDDVEKDEERELL LKTAVSEKMLRPTGRVVGIIKRNWRPYCGMLSKSDIKE - UNI36915 -

 SRRHLFTPADKRIPRIRIETRQASALEGRRIIVAIDGWPRNSRYPN - UNI36915 - GHFVKNLGDVGEKETETEVLLLEHDVPHQPFSQAVLSFL

PRMPWSITEE - UNI1914 - - UNI36915 - DMKNREDLRHLCVCSVDPPGCTDIDDALHCRELSNGNLE VGVHIADVSHFIRPGNALDQESAR

RGTTVYLCEK RIDMVPELLSSNLCSLRSNVDR - UNI28465 - RLLLRTRKHR - UNI28465 -       
Transcript ENSMUST00000116452
Sequence
AAAAAATGGCAGGTGTCCTGTCAAAAGACAACCATCCATGTTTCCTCACGCCTCAATACAGTGCCTAGGTACTTGAATTTAAAAATAGTAACTTATTTTT

CAGGTGAAGAATACGTAAAGAGCCTGACTGCTAACCCTGAACTTATAGACCGTCTTGCTTACTTGTCCGATGAAATG AATGAAATAGAAAGTGGGAAAA

TAATATTTTCAGAGCATCTTCCCTTAAGCAAGCTCCAACAAGGCATAAAATCTGGTTCCTATCTTCAAGGAACATTCAGAGCTAGCAGGGAAAATTATTT

GGAGGCTACAGTATGGATTCATGGAGACAAAGAAGAGGAAAAAGAG - UNI2457 - ATACTTATACAGGGAATTAAGCATCTAAACAGAGCTGTGCA

TGAAGACATTGTGGCCGTGGAGCTACTGCCCAGGAGCCAGTGGGTGGCACCGTCTTCCGTGGTTTTAGACGATGAAGGTCAAAATGAAGACGATGTGGAG

AAAGATGAGGAGAGAGAACTCCTG CTTAAGACTGCTGTAAGTGAAAAAATGTTACGGCCTACAGGTCGAGTTGTGGGGATAATAAAAAGGAACTGGAGA

CCGTATTGTGGCATGCTTTCCAAGTCTGATATTAAGGAG - UNI36915 - TCAAGAAGACATCTCTTTACACCCGCTGATAAGAGAATTCCACGAAT

TCGGATAGAAACCAGACAGGCTTCTGCGTTAGAAGGACGGAGAATTATTGTCGCTATTGATGGTTGGCCTAGAAATTCTAGATATCCAAAT - UNI369

15 - GGACACTTTGTAAAGAATTTAGGCGATGTTGGAGAGAAGGAGACAGAAACGGAAGTGTTGCTGCTCGAGCACGATGTTCCTCATCAGCCCTTTTC

CCAGGCTGTGCTTAGCTTCCTGCCCAGGATGCCCTGGAGCATTACTGAGGAG - UNI1914 - - UNI36915 - GACATGAAAAACCGAGAAGACC

TGAGACATCTGTGTGTTTGCAGTGTGGACCCTCCAGGGTGCACTGACATAGATGACGCTCTGCATTGTAGAGAGCTCAGCAATGGAAACTTGGAG GTTG

GTGTTCATATTGCGGATGTTAGCCATTTTATCAGGCCAGGAAATGCGTTGGATCAAGAATCTGCAAGAAGAGGAACAACTGTTTATCTTTGTGAAAAG A

GGATTGACATGGTTCCAGAGTTGCTCAGCTCCAACCTCTGTTCCTTAAGATCCAACGTTGACAG GTTGGCATTTTCCTGTATTTGGGAAATGAATCATA

ATGCTGAAATATTAAAAACGAGATTTACCAAAAGTGTCATTAATTCAAAG - UNI28465 - GCTTCTCTTACGTACGCGGAAGCACAGATGAGAATT

GATTCGGCGGCTATGAATGATGATATTACCACTAGTCTCCGTGGACTCAATCAGCTGGCTAAAATTCTAAAAAAGGGAAGGATTGAAAAGGG - UNI28

465 - GGCTTTGACTCTGTCTTCTCCAGAGATCCGATTCCACATGGACAGTGAAACCCACGACCCAATCGACCTGCAGACGAAAGAGCTGAG AGAAAC

AAATTCCATGGTGGAAGAATTTATGTTACTTGCTAATATTTCTGTCGCAAAAAAAATTCATGAAGAGTTTTCTGAACATGCTCTGCTTCGGAAACACCCA

GCTCCGCCTCCCTCGAATTATGACATTCTTGTTAAGGCTGCAAAGTCCAAG AATTTGCAAATTAAGACTGATACAGCCAAATCTTTGGCCGACTCTTTG

GACCGGGCTGAATCTCCGGATTTCCCATACCTGAATACTCTATTAAGGATACTGGCCACTCGCTGTATGATGCAAGCTGTGTACTTCTGCTCTGGGATGG

ATAATGATTTTCATCACTATGGCTTAGCCTCCCCCATATACACACATTTCACCTCTCCTATCAGAAG ATATGCAGACATAATTGTCCATCGGCTATTAG

CTGTGGCGATTGGGGCTGACTGTACTTACCCTGAGTTGACAGACAAACACAAGCTTTCAGATATATGTAAAAACCTCAATTTCCGGCATAAAATGGCTCA

GTATGCCCAGCGTGCTTCGGTGGCTTTTCATACACAG TTGTTTTTCAAAAGCAAAGGAATAGTAAGTGAAGAAGCCTATATTCTCTTTGTAAGGAAAAA

TGCAATTGTGGTGTTAATTCCAAAGTATGGCTTAGAAGGTACAGTTTTCTTTGAAGAAAAAGATAAACCAAAGCCACGCCTTGCTTACGATGATGAG AT

CCCTTCCCTGAGAATAGAAGGTACAGTGTTCCATGTGTTTGATAAGGTTAAAGTGAAGATCACATTAGATTCATCAAATCTTCAACATCAGAAAATCCGC

ATGGCCCTTGTAGAACCACAG ATCCCAGGAATAAATATTCCTCCTAATGTTGCAGACAAGGCTCTTACTGCACCAGGGGGAAAGAAGAGGAAGCTTGAG

AAGTAGCTACGTTCAACAGAACATCCAAAGACTCAACAGCAACAAAATGGAGAGCATACTTACAGACTCCTGTGCGATAGCTACTTTTAAATACATTTCA

ATAATTTTAACAAATTTGCATTTTTATTGAGTTGCTGACTGAATCTATCTTATACTGTGCTTCTGCAACAACAAAAATTATGCAGAAAAATTCATTTGAA

TATCCATCACTTAAATGGTGACAATAACAACTTCAGAGATCTGTGATGATCATTTAAATGGAGTACTCATCTTCTCATAGAAGAGCCGATTAATATTATC

TAAGTACTTTAGTAGAAAACAACCTGTCAATTTCTGAGGAAAATAACATTTTAGAAGCAAAGAACAAGCCTTTCTAAATCTTCAGCTGTCAGCGTTTGGC

ATTTAATCTTTTTGCCATTTTAATTTGCCTACTTACATTGTGTTCATATATTTTGAAAAGACTTCTCTACTTTACCGTGGTCCTCCGTTGTGAGTGTTGC

AGGGCTATAGGAAGACAAAGCCTGGGGTACCCGCATCTGGTTTGGAACCCTGAGTTTTGTTGTTCAGTCAGCAGCCCTAGTCATGGTTGCCAATAGTTTT

CCCAAGCAAGGCGTCACCGAGGAGGAAGAAAGGGGGTACTCTCATGTCTGCTTACTCACAAAAACAGATAGTGGCTTAGGAATTGTGGTTATATCCAGTT

ATACAGGCGAGGAGGGGCTGTGGTAAAGACAGATTAAAAGGAACAAATGAAGTC
Translation
M NEIESGKIIFSEHLPLSKLQQGIKSGSYLQGTFRASRENYLEATVWIHGDKEEEKE - UNI2457 - ILIQGIKHLNRAVHEDIVAVELLPRSQWV

APSSVVLDDEGQNEDDVEKDEERELL LKTAVSEKMLRPTGRVVGIIKRNWRPYCGMLSKSDIKE - UNI36915 - SRRHLFTPADKRIPRIRIETR

QASALEGRRIIVAIDGWPRNSRYPN - UNI36915 - GHFVKNLGDVGEKETETEVLLLEHDVPHQPFSQAVLSFLPRMPWSITEE - UNI1914 -

 - UNI36915 - DMKNREDLRHLCVCSVDPPGCTDIDDALHCRELSNGNLE VGVHIADVSHFIRPGNALDQESARRGTTVYLCEK RIDMVPELLSS

NLCSLRSNVDR RLAFSCIWEMNHNAEILKTRFTKSVINSK - UNI28465 - ASLTYAEAQMRIDSAAMNDDITTSLRGLNQLAKILKKGRIEKG -

 UNI28465 - GALTLSSPEIRFHMDSETHDPIDLQTKELR RETNSMVEEFMLLANISVAKKIHEEFSEHALLRKHPAPPPSNYDILVKAAKSK NLQ

IKTDTAKSLADSLDRAESPDFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRR RYADIIVHRLLAVAIGADCTYPELTDKHKL

SDICKNLNFRHKMAQYAQRASVAFHTQ LFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPKPRLAYDDE IPSLRIEGTVFHVFDKVK

VKITLDSSNLQHQKIRMALVEPQ IPGINIPPNVADKALTAPGGKKRKLEK
Transcript ENSMUST00000042471
Sequence
GCGGGAATGCGCGTGGCCGCGCCTCGGTTTCTTAGCTGACGGCCGGGATCCCACGCCGCGAGGCGAGATGCTCAGGTCCAAGACGTTCTTGAAGAAGACC

CGCGCGGGCGGCGTGGTGAAGATCGTGCGCGAGCACTACCTGCGGGATGACATCGGCTGCGGCGCGCCGGCTTGCTCGGCCTGCGGCGGGGCGCACGCGG

GCCCGGCCCTGGAGCTGCAGCCCCGGGACCAGGCGAGCAGCCTCTGCCCGTGGCCGCACTACCTTCTGCCGGACACCAATGTGCTGCTGCACCAG ATTG

ATGTCCTCGAACACCCGGCCATCAGAAATGTCATTGTGCTACAAACAGTGATGCAAGAAGTGAGAAACCGGAGCGCCCCCATCTACAAGCGAATCAGGGA

TGTGACCAATAACCAGGAAAAGCATTTCTATACCTTCACTAATGAGCACCATAA AGAAACCTACATCGAGCAAGAGCAGGGAGAGAATGCCAATGACAG

GAATGACAGAGCCATCCGAGTCGCAGCGAAGTGGTACAACGAGCACCTGAAGAGGGTGGCAGCAGACAGTCAGCTGCAAGTTATCCTGATAACCAATGAC

AGGAAGAACAAAGAGAAAGCTGTGCAAGAGGGGATACCAGCCTTCACGT GTGAAGAATACGTAAAGAGCCTGACTGCTAACCCTGAACTTATAGACCGT

CTTGCTTACTTGTCCGATGAAATG AATGAAATAGAAAGTGGGAAAATAATATTTTCAGAGCATCTTCCCTTAAGCAAGCTCCAACAAGGCATAAAATCT

GGTTCCTATCTTCAAGGAACATTCAGAGCTAGCAGGGAAAATTATTTGGAGGCTACAGTATGGATTCATGGAGACAAAGAAGAGGAAAAAGAG - UNI2

457 - ATACTTATACAGGGAATTAAGCATCTAAACAGAGCTGTGCATGAAGACATTGTGGCCGTGGAGCTACTGCCCAGGAGCCAGTGGGTGGCACCGT

CTTCCGTGGTTTTAGACGATGAAGGTCAAAATGAAGACGATGTGGAGAAAGATGAGGAGAGAGAACTCCTG CTTAAGACTGCTGTAAGTGAAAAAATGT

TACGGCCTACAGGTCGAGTTGTGGGGATAATAAAAAGGAACTGGAGACCGTATTGTGGCATGCTTTCCAAGTCTGATATTAAGGAG - UNI36915 - 

TCAAGAAGACATCTCTTTACACCCGCTGATAAGAGAATTCCACGAATTCGGATAGAAACCAGACAGGCTTCTGCGTTAGAAGGACGGAGAATTATTGTCG

CTATTGATGGTTGGCCTAGAAATTCTAGATATCCAAAT - UNI36915 - GGACACTTTGTAAAGAATTTAGGCGATGTTGGAGAGAAGGAGACAGAA

ACGGAAGTGTTGCTGCTCGAGCACGATGTTCCTCATCAGCCCTTTTCCCAGGCTGTGCTTAGCTTCCTGCCCAGGATGCCCTGGAGCATTACTGAGGAG 

- UNI1914 - - UNI36915 - GACATGAAAAACCGAGAAGACCTGAGACATCTGTGTGTTTGCAGTGTGGACCCTCCAGGGTGCACTGACATAGAT

GACGCTCTGCATTGTAGAGAGCTCAGCAATGGAAACTTGGAG GTTGGTGTTCATATTGCGGATGTTAGCCATTTTATCAGGCCAGGAAATGCGTTGGAT

CAAGAATCTGCAAGAAGAGGAACAACTGTTTATCTTTGTGAAAAG AGGATTGACATGGTTCCAGAGTTGCTCAGCTCCAACCTCTGTTCCTTAAGATCC

AACGTTGACAG GTTGGCATTTTCCTGTATTTGGGAAATGAATCATAATGCTGAAATATTAAAAACGAGATTTACCAAAAGTGTCATTAATTCAAAG - 

UNI28465 - GCTTCTCTTACGTACGCGGAAGCACAGATGAGAATTGATTCGGCGGCTATGAATGATGATATTACCACTAGTCTCCGTGGACTCAATCA

GCTGGCTAAAATTCTAAAAAAGGGAAGGATTGAAAAGGG - UNI28465 - GGCTTTGACTCTGTCTTCTCCAGAGATCCGATTCCACATGGACAGTG

AAACCCACGACCCAATCGACCTGCAGACGAAAGAGCTGAG AGAAACAAATTCCATGGTGGAAGAATTTATGTTACTTGCTAATATTTCTGTCGCAAAAA

AAATTCATGAAGAGTTTTCTGAACATGCTCTGCTTCGGAAACACCCAGCTCCGCCTCCCTCGAATTATGACATTCTTGTTAAGGCTGCAAAGTCCAAG A

ATTTGCAAATTAAGACTGATACAGCCAAATCTTTGGCCGACTCTTTGGACCGGGCTGAATCTCCGGATTTCCCATACCTGAATACTCTATTAAGGATACT

GGCCACTCGCTGTATGATGCAAGCTGTGTACTTCTGCTCTGGGATGGATAATGATTTTCATCACTATGGCTTAGCCTCCCCCATATACACACATTTCACC

TCTCCTATCAGAAG ATATGCAGACATAATTGTCCATCGGCTATTAGCTGTGGCGATTGGGGCTGACTGTACTTACCCTGAGTTGACAGACAAACACAAG

CTTTCAGATATATGTAAAAACCTCAATTTCCGGCATAAAATGGCTCAGTATGCCCAGCGTGCTTCGGTGGCTTTTCATACACAG TTGTTTTTCAAAAGC

AAAGGAATAGTAAGTGAAGAAGCCTATATTCTCTTTGTAAGGAAAAATGCAATTGTGGTGTTAATTCCAAAGTATGGCTTAGAAGGTACAGTTTTCTTTG

AAGAAAAAGATAAACCAAAGCCACGCCTTGCTTACGATGATGAG ATCCCTTCCCTGAGAATAGAAGGTACAGTGTTCCATGTGTTTGATAAGGTTAAAG

TGAAGATCACATTAGATTCATCAAATCTTCAACATCAGAAAATCCGCATGGCCCTTGTAGAACCACAG ATCCCAGGAATAAATATTCCTCCTAATGTTG

CAGACAAGGCTCTTACTGCACCAGGGGGAAAGAAGAGGAAGCTTGAGAAGTAGCTACGTTCAACAGAACATCCAAAGACTCAACAGCAACAAAATGGAGA

GCATACTTACAGACTCCTGTGCGATAGCTACTTTTAAATACATTTCAATAATTTTAACAAATTTG
Translation
MLRSKTFLKKTRAGGVVKIVREHYLRDDIGCGAPACSACGGAHAGPALELQPRDQASSLCPWPHYLLPDTNVLLHQ IDVLEHPAIRNVIVLQTVMQEVR

NRSAPIYKRIRDVTNNQEKHFYTFTNEHHK KETYIEQEQGENANDRNDRAIRVAAKWYNEHLKRVAADSQLQVILITNDRKNKEKAVQEGIPAFTC CE

EYVKSLTANPELIDRLAYLSDEM NEIESGKIIFSEHLPLSKLQQGIKSGSYLQGTFRASRENYLEATVWIHGDKEEEKE - UNI2457 - ILIQGIK

HLNRAVHEDIVAVELLPRSQWVAPSSVVLDDEGQNEDDVEKDEERELL LKTAVSEKMLRPTGRVVGIIKRNWRPYCGMLSKSDIKE - UNI36915 -

 SRRHLFTPADKRIPRIRIETRQASALEGRRIIVAIDGWPRNSRYPN - UNI36915 - GHFVKNLGDVGEKETETEVLLLEHDVPHQPFSQAVLSFL

PRMPWSITEE - UNI1914 - - UNI36915 - DMKNREDLRHLCVCSVDPPGCTDIDDALHCRELSNGNLE VGVHIADVSHFIRPGNALDQESAR

RGTTVYLCEK RIDMVPELLSSNLCSLRSNVDR RLAFSCIWEMNHNAEILKTRFTKSVINSK - UNI28465 - ASLTYAEAQMRIDSAAMNDDITT

SLRGLNQLAKILKKGRIEKG - UNI28465 - GALTLSSPEIRFHMDSETHDPIDLQTKELR RETNSMVEEFMLLANISVAKKIHEEFSEHALLRKH

PAPPPSNYDILVKAAKSK NLQIKTDTAKSLADSLDRAESPDFPYLNTLLRILATRCMMQAVYFCSGMDNDFHHYGLASPIYTHFTSPIRR RYADIIVH

RLLAVAIGADCTYPELTDKHKLSDICKNLNFRHKMAQYAQRASVAFHTQ LFFKSKGIVSEEAYILFVRKNAIVVLIPKYGLEGTVFFEEKDKPKPRLAY

DDE IPSLRIEGTVFHVFDKVKVKITLDSSNLQHQKIRMALVEPQ IPGINIPPNVADKALTAPGGKKRKLEK

For any suggestions or comments, please send an email to unitrap@crg.es