Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033256 (Shf)
Chromosomal location
Chr 2: 122174629 - 122194568 (-)
Description
Src homology 2 domain containing F Gene [Source:MGI (curated);Acc:Shf-001]
RefSeq_dna
NM_001013829 
RefSeq_peptide
NP_001013851.2 
UniGene
Mm.458215 
MGI
MGI:3613669 
Uniprot/SWISSPROT
Q8CG80 
Uniprot/SPTREMBL
A2AQ88 A2AQ89 B0R096 
Human Ortholog
ENSG00000138606 (SHF)
Omim not available
UniTrap UNI16442
Vector Insertion
Chr 2: 122185326 - 122192419
Public Clones (sanger)
Private Clones OST461203 (lexicon) OST56196 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19979
Vector Insertion
Chr 2: 122175276 - 122179500
Public Clones not available
Private Clones OST376058 (lexicon)
Severity of mutation (?) Insertion after 81% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000110532
Sequence
GACCGCGACTTCGAGGACCCCTACTCCGGGGGCCCGTCCGCGTCCGCCGCCCTTTCCACCCCTGCGGTCCCTGGCCCCACTCCGCCCCCGCGCCACGGCT

CACCCCCGCACCGCCTCATTCGGGTCGAGACCCCCGGCCCCCCAGCACCCCCTCCGGACTCCGGACCCCCTGCCAGCAGCGACAGG - UNI16442 - 

TTGGCAATCCTAGAGGACTATGCGGACCCATTTGATGTTCAGGAGACTGGTGAAGGCTCAGGAGGGACTTCAGGAGCCCCGGGGAAGGTCCCTGAGAATG

ATGGCTACATGGAGCCCTACGAGGCCCAAAAGATGATGGCTG AGATCCGGGGTTCTAAGGAGACTGCAGCTCAACCCCTACCTCTCTATGACACACCCT

ATGAGCCAGAAGATGAGGGGGCCAGCCCAGAAGGTGAGGGGACTCCCTGGCCCAGGGAGTCGCGCCTGCCAGAGGATGACGAGAGGCCTCCAGAAGAGTA

TGACCAGCCCTGGGAGTGGAAGAAGGAACGGATTTCCAAAGCCTTTGCTG CCCAGTTTGAAGGATCGGAGAACTGCCTGTCACCTGGCCGGGAGGAGAA

GGGGCGGCTACCTCCCAGGCTATCTGCTGGGAACCCCAAGTCAGCCAAGCCCCTAGGCATGGAACCCAGCAGCCCCCTGGGGGAGTGGACAGATCCAGCA

CTGCCTCTGGAAAACCAGGT - UNI19979 - GAGCAGTCAGGGCTTCATGCACATGAAGCTGTCCCGGACTAAGGAACACAAGTATGTGTTGGGCCA

GAACAGCCCACCCTTCAGCAGCGTCCCTGAAATCGTGCACCACTATGCCAGCCGCAAGCTGCCCATTAAGGGAGCGGAACACATGTCCCTGCTCTACCCT

GTGGCCATCCGGACTCTGTAGATGTGAGACCAGGGCACTATGATAGACCTGGACCCAGTCCTTGTCACCTGCACGGGGGCAGCGGTTCTTACCAAGGACA

TGATGTCAGAAACCTGGCTTCCCCTTGTCCTAGGATCTAGCAGGCGCTGAAGATTCCTTAATTTATTATAAAGGGGAGGGAATCCTGGGCCTTGGAATAA

AGGGACTGTGTGGAGCTGGGCACCGAGGAGAGCCTGAGGAGGAAGGGGTCTCCCCGCCCCAGTCAGACACTAGGGAGGGAGTGGCGACCTCCCTCCCGCA

CCACCCACCCTCCGCATCCTCCCTTCTCCCCGTCCCCAGCGGGCCGCCCGGGCTCCGGGCCAGAGGCTCGGCCAGGCAGAGCTGCGGCTGCCGGCGCCGC

CCAGGGGCTGCCGGGAGGGGGCGGGGAGCGAGCCCGACTATAAATTGAGGCTGGAGCCGACGCCGGCCGCCTGCGAAAAGC
Translation
DRDFEDPYSGGPSASAALSTPAVPGPTPPPRHGSPPHRLIRVETPGPPAPPPDSGPPASSDR - UNI16442 - LAILEDYADPFDVQETGEGSGGTS

GAPGKVPENDGYMEPYEAQKMMAE EIRGSKETAAQPLPLYDTPYEPEDEGASPEGEGTPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAA AQFE

GSENCLSPGREEKGRLPPRLSAGNPKSAKPLGMEPSSPLGEWTDPALPLENQV - UNI19979 - VSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPE

IVHHYASRKLPIKGAEHMSLLYPVAIRTL
Transcript ENSMUST00000110531
Sequence
AAAGGATCCAGGATGTAGCATCTGAGCTGTCCCATGGGCTGACCTAGGCTCCTCGTTATTCAGAAATCAATCAACTCCCAACCATCTAGGAACAGAATTT

GAGAGATCCCAGAGTATTCCCCGAGGAAAAGCGAAGCCAGACAAG - UNI16442 - TTGGCAATCCTAGAGGACTATGCGGACCCATTTGATGTTCA

GGAGACTGGTGAAGGCTCAGGAGGGACTTCAGGAGCCCCGGGGAAGGTCCCTGAGAATGATGGCTACATGGAGCCCTACGAGGCCCAAAAGATGATGGCT

G AGATCCGGGGTTCTAAGGAGACTGCAGCTCAACCCCTACCTCTCTATGACACACCCTATGAGCCAGAAGATGAGGGGGCCAGCCCAGAAGGTGAGGGG

ACTCCCTGGCCCAGGGAGTCGCGCCTGCCAGAGGATGACGAGAGGCCTCCAGAAGAGTATGACCAGCCCTGGGAGTGGAAGAAGGAACGGATTTCCAAAG

CCTTTGCTG TTGACATAAAGGTCATCAAAGACCTACCTTGGCCTCCGCCGGTGGGACAGCTGGACAGCAGCCCCTCCCTGCCTGACGGGGACAGGGACA

TCTCCGGTCCAGCTTCACCCCTCCCTGAGCCCAGCCTGGAGGACAGCAGCG CCCAGTTTGAAGGATCGGAGAACTGCCTGTCACCTGGCCGGGAGGAGA

AGGGGCGGCTACCTCCCAGGCTATCTGCTGGGAACCCCAAGTCAGCCAAGCCCCTAGGCATGGAACCCAGCAGCCCCCTGGGGGAGTGGACAGATCCAGC

ACTGCCTCTGGAAAACCAGGT CTGGTACCACGGGGCCATCAGCCGAACAGATGCCGAGAACCTGCTCAGGCTGTGCAAAGAGGCCAGCTACCTGGTGCG

CAACAGTGAGACCAGCAAAAATGACTTCTCTCTCTCCCTCAA - UNI19979 - GAGCAGTCAGGGCTTCATGCACATGAAGCTGTCCCGGACTAAGG

AACACAAGTATGTGTTGGGCCAGAACAGCCCACCCTTCAGCAGCGTCCCTGAAATCGTGCACCACTATGCCAGCCGCAAGCTGCCCATTAAGGGAGCGGA

ACACATGTCCCTGCTCTACCCTGTGGCCATCCGGACTCTGTAGATGTGAGACCAGGGCACTATGATAGACCTGGACCCAGTCCTTGTCACCTGCACGGGG

GCAGCGGTTCTTACCAAGGACATGATGTCAGAAACCTGGCTTCCCCTTGTCCTAGGATCTAGCAGGCGCTGAAGATTCCTTAATTTATTATAAAGGGGAG

GGAATCCTGGGCCTTGGAATAAAGGGACTGTGTGGAGCTGGGCACCGAGGAGAGCCTGAGGAGGAAGGGGTCTCCCCGCCCCAGTCAGACACTAGGGAGG

GAGTGGCGACCTCCCTCCCGCACCACCCACCCTCCGCATCCTCCCTTCTCCCCGTCCCCAGCGGGCCGCCCGGGCTCCGGGCCAGAGGCTCGGCCAGGCA

GAGCTGCGGCTGCCGGCGCCGCCCAGGGGCTGCCGGGAGGGGGCGGGGAGCGAGCCCGACTATAAATTGAGGCTGGAGCCGACGCCGGCCGCCTGCGAAA

AGC
Translation
 - UNI16442 - AILEDYADPFDVQETGEGSGGTSGAPGKVPENDGYMEPYEAQKMMAE EIRGSKETAAQPLPLYDTPYEPEDEGASPEGEGTPWPR

ESRLPEDDERPPEEYDQPWEWKKERISKAFAV VDIKVIKDLPWPPPVGQLDSSPSLPDGDRDISGPASPLPEPSLEDSSA AQFEGSENCLSPGREEKG

RLPPRLSAGNPKSAKPLGMEPSSPLGEWTDPALPLENQV VWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLK - UNI19979 - KSSQG

FMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Transcript ENSMUST00000048635
Sequence
AAAGGATCCAGGATGTAGCATCTGAGCTGTCCCATGGGCTGACCTAGGCTCCTCGTTATTCAGAAATCAATCAACTCCCAACCATCTAGGAACAGAATTT

GAGAGATCCCAGAGTATTCCCCGAGGAAAAGCGAAGCCAGACAAG - UNI16442 - TTGGCAATCCTAGAGGACTATGCGGACCCATTTGATGTTCA

GGAGACTGGTGAAGGCTCAGGAGGGACTTCAGGAGCCCCGGGGAAGGTCCCTGAGAATGATGGCTACATGGAGCCCTACGAGGCCCAAAAGATGATGGCT

G AGATCCGGGGTTCTAAGGAGACTGCAGCTCAACCCCTACCTCTCTATGACACACCCTATGAGCCAGAAGATGAGGGGGCCAGCCCAGAAGGTGAGGGG

ACTCCCTGGCCCAGGGAGTCGCGCCTGCCAGAGGATGACGAGAGGCCTCCAGAAGAGTATGACCAGCCCTGGGAGTGGAAGAAGGAACGGATTTCCAAAG

CCTTTGCTG CCCAGTTTGAAGGATCGGAGAACTGCCTGTCACCTGGCCGGGAGGAGAAGGGGCGGCTACCTCCCAGGCTATCTGCTGGGAACCCCAAGT

CAGCCAAGCCCCTAGGCATGGAACCCAGCAGCCCCCTGGGGGAGTGGACAGATCCAGCACTGCCTCTGGAAAACCAGGT CTGGTACCACGGGGCCATCA

GCCGAACAGATGCCGAGAACCTGCTCAGGCTGTGCAAAGAGGCCAGCTACCTGGTGCGCAACAGTGAGACCAGCAAAAATGACTTCTCTCTCTCCCTCAA

 - UNI19979 - GAGCAGTCAGGGCTTCATGCACATGAAGCTGTCCCGGACTAAGGAACACAAGTATGTGTTGGGCCAGAACAGCCCACCCTTCAGCA

GCGTCCCTGAAATCGTGCACCACTATGCCAGCCGCAAGCTGCCCATTAAGGGAGCGGAACACATGTCCCTGCTCTACCCTGTGGCCATCCGGACTCTGTA

GATGTGAGACCAGGGCACTATGATAGACCTGGACCCAGTCCTTGTCACCTGCACGGGGGCAGCGGTTCTTACCAAGGACATGATGTCAGAAACCTGGCTT

CCCCTTGTCCTAGGATCTAGCAGGCGCTGAAGATTCCTTAATTTATTATAAAGGGGAGGGAATCCTGGGCCTTGGAATAAAGGGACTGTGTGGAGCTGGG

CACCGAGGAGAGCCTGAGGAGGAAGGGGTCTCCCCGCCCCAGTCAGACACTAGGGAGGGAGTGGCGACCTCCCTCCCGCACCACCCACCCTCCGCATCCT

CCCTTCTCCCCGTCCCCAGCGGGCCGCCCGGGCTCCGGGCCAGAGGCTCGGCCAGGCAGAGCTGCGGCTGCCGGCGCCGCCCAGGGGCTGCCGGGAGGGG

GCGGGGAGCGAGCCCGACTATAAATTGAGGCTGGAGCCGACGCCGGCCGCCTGCGAAAAGC
Translation
 - UNI16442 - MEPYEAQKMMAE EIRGSKETAAQPLPLYDTPYEPEDEGASPEGEGTPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAA AQ

FEGSENCLSPGREEKGRLPPRLSAGNPKSAKPLGMEPSSPLGEWTDPALPLENQV VWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLK - 

UNI19979 - KSSQGFMHMKLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Transcript ENSMUST00000110530
Sequence
ATGCAGAAACATCGAG AGATCCGGGGTTCTAAGGAGACTGCAGCTCAACCCCTACCTCTCTATGACACACCCTATGAGCCAGAAGATGAGGGGGCCAGC

CCAGAAGGTGAGGGGACTCCCTGGCCCAGGGAGTCGCGCCTGCCAGAGGATGACGAGAGGCCTCCAGAAGAGTATGACCAGCCCTGGGAGTGGAAGAAGG

AACGGATTTCCAAAGCCTTTGCTG CCCAGTTTGAAGGATCGGAGAACTGCCTGTCACCTGGCCGGGAGGAGAAGGGGCGGCTACCTCCCAGGCTATCTG

CTGGGAACCCCAAGTCAGCCAAGCCCCTAGGCATGGAACCCAGCAGCCCCCTGGGGGAGTGGACAGATCCAGCACTGCCTCTGGAAAACCAGGT CTGGT

ACCACGGGGCCATCAGCCGAACAGATGCCGAGAACCTGCTCAGGCTGTGCAAAGAGGCCAGCTACCTGGTGCGCAACAGTGAGACCAGCAAAAATGACTT

CTCTCTCTCCCTCAA - UNI19979 - GAGCAGTCAGGGCTTCATGCACATGAAGCTGTCCCGGACTAAGGAACACAAGTATGTGTTGGGCCAGAACA

GCCCACCCTTCAGCAGCGTCCCTGAAATCGTGCACCACTATGCCAGCCGCAAGCTGCCCATTAAGGGAGCGGAACACATGTCCCTGCTCTACCCTGTGGC

CATCCGGACTCTGTAGATGTGAGACCAGGGCACTATGATAGACCTGGACCCAGTCCTTGTCACCTGCACGGGGGCAGCGGTTCTTACCAAGGACATGATG

TCAGAAACCTGGCTTCCCCTTGTCCTAGGATCTAGCAGGCGCTGAAGATTCCTTAATTTATTATAAAGGGGAGGGAATCCTGGGCCTTGGAATAAAGGGA

CTGTGTGGAGCTGGGCACCGAGGAGAGCCTGAGGAGGAAGGGGTCTCCCCGCCCCAGTCAGACACTAGGGAGGGAGTGGCGACCTCCCTCCCGCACCACC

CACCCTCCGCATCCTCCCTTCTCCCCGTCCCCAGCGGGCCGCCCGGGCTCCGGGCCAGAGGCTCGGCCAGGCAGAGCTGCGGCTGCCGGCGCCGCCCAGG

GGCTGCCGGGAGGGGGCGGGGAGCGAGCCCGACTATAAATTGAGGCTGGAGCCGACGCCGGCCGCCTGCGAAAAGC
Translation
MQKHRE EIRGSKETAAQPLPLYDTPYEPEDEGASPEGEGTPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAA AQFEGSENCLSPGREEKGRLPP

RLSAGNPKSAKPLGMEPSSPLGEWTDPALPLENQV VWYHGAISRTDAENLLRLCKEASYLVRNSETSKNDFSLSLK - UNI19979 - KSSQGFMHM

KLSRTKEHKYVLGQNSPPFSSVPEIVHHYASRKLPIKGAEHMSLLYPVAIRTL
Transcript ENSMUST00000121237
Sequence
GGCACTGGAAAAGAGCAGATGAAGTTAAAGAATGCAGAAACATCGAG AGATCCGGGGTTCTAAGGAGACTGCAGCTCAACCCCTACCTCTCTATGACAC

ACCCTATGAGCCAGAAGATGAGGGGGCCAGCCCAGAAGGTGAGGGGACTCCCTGGCCCAGGGAGTCGCGCCTGCCAGAGGATGACGAGAGGCCTCCAGAA

GAGTATGACCAGCCCTGGGAGTGGAAGAAGGAACGGATTTCCAAAGCCTTTGCTG CCCAGTTTGAAGGATCGGAGAACTGCCTGTCACCTGGCCGGGAG

GAGAAGGGGCGGCTACCTCCCAGGCTATCTGCTGGGAACCCCAAGTCAGCCAAGCCCCTAGGCATGGAACCCAGCAGCCCCCTGGGGGAGTGGACAGATC

CAGCACTGCCTCTGGAAAACCAG CTGGTACCACGGGGCCATCAGCCGAACAGATGCCGAGAACCTGCTCAGGCTGTGCAAAGAGGCCAGCTACCTGGTG

CGCAACAGTGAGACCAGCAAAAATGACTTCTCTCTCTCCCTCAA - UNI19979 - GAGCAGTCAGGGCTTCATGCACATGAAGCTGTCCCGGACTAA

GGAACACAAGTATGTGTTGGGCCAGAACAGCCCACCCTTCAGCAGCGTCCCTGAAATCGTGCACCACTATGCCAGCCGCAAGCTGCCCATTAAGGGAGCG

GAACACATGTCCCTGCTCTACCCTGTGGCCATCCGGACTCTGTAGATGTGAGACCAGGGCACTATGATAGACCTGGACCCAGTCCTTGTCACCTGCACGG

GGGCAGCGGTTCTTACCAAGGACATGATGTCAGAAACCTGGCTTCCCCTTGTCCTAGGATCTAGCAGGCGCTGAAGATTCCTTAATTTATTATAAAGGG
Translation
MQKHRE EIRGSKETAAQPLPLYDTPYEPEDEGASPEGEGTPWPRESRLPEDDERPPEEYDQPWEWKKERISKAFAA AQFEGSENCLSPGREEKGRLPP

RLSAGNPKSAKPLGMEPSSPLGEWTDPALPLENQ LVPRGHQPNRCREPAQAVQRGQLPGAQQ - UNI19979 - 

For any suggestions or comments, please send an email to unitrap@crg.es