Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033335 (Dnm2)
Chromosomal location
Chr 9: 21229415 - 21311568 (+)
Description
dynamin 2 Gene [Source:MGI Symbol;Acc:MGI:109547]
RefSeq_peptide
NP_001034609.1 
UniGene
Mm.433257 
MGI
MGI:109547 
Uniprot/SWISSPROT
P39054 
Uniprot/SPTREMBL
Q3TBU6 Q3TCR7 Q91Z39 Q9CUM4 Q3T9X3 
Human Ortholog
ENSG00000079805 (DNM2)
Omim 160150 - MYOPATHY, CENTRONUCLEAR, AUTOSOMAL DOMINANT  606482 - CHARCOT-MARIE-TOOTH DISEASE, DOMINANT INTERMEDIATE B  
UniTrap UNI909
Vector Insertion
Chr 9: 21229701 - 21261946
Public Clones BC0412 (sanger) (sanger) CSH575 (baygenomics) RRY010 (baygenomics) P011C04 (ggtc)
3SE223F07 (ggtc) D094D09 (ggtc) FHCRC-GT-S1-3B1 (fhcrc) IST12775H1 (tigm)
IST11765B12 (tigm) IST13663H4 (tigm) IST14329G11 (tigm) IST12247G11 (tigm)
IST11034H7 (tigm) IST12689H12 (tigm) IST13358H11 (tigm) IST13172H6 (tigm)
IST11024A6 (tigm) IST11573H12 (tigm) IST14425E6 (tigm) IST13879D10 (tigm)
IST10111C9 (tigm) IST14813D3 (tigm) IST13405B10 (tigm)
Private Clones OST455742 (lexicon) OST455741 (lexicon) OST435018 (lexicon) OST429579 (lexicon)
OST411144 (lexicon) OST218912 (lexicon) OST142056 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17299
Vector Insertion
Chr 9: 21262021 - 21270025
Public Clones (sanger) IST14791A6 (tigm) IST11858H2 (tigm) IST14599B5 (tigm) IST14351B12 (tigm)
IST14418G9 (tigm) IST14407C10 (tigm) IST10608E3 (tigm)
Private Clones OST445741 (lexicon) OST429885 (lexicon) OST352614 (lexicon) OST298124 (lexicon)
OST282077 (lexicon) OST100946 (lexicon) OST50825 (lexicon) OST32657 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5748
Vector Insertion
Chr 9: 21270176 - 21271975
Public Clones CSI438 (baygenomics) IST12456D4 (tigm)
Private Clones OST440941 (lexicon) OST388228 (lexicon) OST266011 (lexicon) OST149002 (lexicon)
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26333
Vector Insertion
Chr 9: 21275886 - 21277056
Public Clones CMHD-GT_485B12-3 (cmhd)
Private Clones OST124770 (lexicon)
Severity of mutation (?) Insertion after 27% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32557
Vector Insertion
Chr 9: 21281053 - 21282724
Public Clones IST12265C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8228
Vector Insertion
Chr 9: 21284990 - 21285776
Public Clones RRF200 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25236
Vector Insertion
Chr 9: 21295114 - 21298947
Public Clones not available
Private Clones OST190801 (lexicon)
Severity of mutation (?) Insertion after 60% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7660
Vector Insertion
Chr 9: 21299062 - 21303701
Public Clones RRS014 (baygenomics) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115404
Sequence
AGCGGGCGTCGCGGCGAAGGGGAGACCGGGCGGGCCGGCAGAGCAGAGCAGGAGGAAGCAACGGCCACAGACACATCGGAACCGAGAGTCTTAGTCGGGG

GATCCGCGCGGCGGAGGCGGACACCATGGGCAACCGCGGGATGGAAGAGCTCATCCCGCTGGTTAACAAGCTGCAGGACGCCTTCAGCTCCATCGGTCAG

AGCTGCCACCTGGACCTGCCGCAGATCGCCGTGGTGGGCGGCCAGAGCGCCGGCAAAAGTTCGGTGCTCGAGAACTTCGTGGGCCG - UNI909 - GG

ACTTCCTTCCACGAGGATCAGGAATTGTCACCCGGAGGCCTCTCATTCTGCAGCTCATCTTTTCCAAAACAG - UNI17299 - AATATGCGGAATTT

TTGCACTGCAAGTCCAAAAAATTTACAGACTTTGATGAAGTCCGGCAGGAGATCGAAGCAGAGACTGACCGGGTCACAGGCACCAACAAAGGCATCTCCC

CTGTGCCCATCAACCTTCGGGTCTACTCACCACACG - UNI5748 - TGTTGAACTTGACCCTCATCGACCTCCCAGGCATCACTAAGGTGCCGGTGG

GGGACCAGCCGCCAGACATCGAGTACCAGATCAAGGACATGATCCTGCAGTTCATCAGCCGCGAGAGCAGCCTCATTCTTGCCGTCACACCTGCCAACAT

GGACTTGGCCAACTCAGACGCCCTCAAGCTGGCCAAGGAGGTGGACCCCCAAG GCCTACGGACCATCGGTGTCATCACCAAGCTAGACTTGATGGATGA

AGGCACAGACGCCAGGGATGTCCTGGAAAACAAGCTACTGCCCTTGAGAAGAG - UNI26333 - GCTATATCGGCGTGGTTAACCGAAGCCAGAAAG

ACATCGAGGGCAAAAAGGACATCCGGGCTGCTCTGGCAGCCGAGAGGAAATTCTTCCTCTCCCACCCAGCCTACCGGCACATGGCTGACCGCATGGGCAC

CCCACACTTGCAGAAAACCCTGAACCAG CAACTGACCAACCACATCCGAGAGTCACTGCCGACCCTTCGCAGCAAGCTGCAGAGCCAACTGCTGTCCCT

GGAGAAGGAAGTGGAAGAGTACAAGAATTTCCGGCCTGATGACCCCACGCGCAAGACCAAAGCCCTGCTGCA GATGGTTCAGCAGTTTGGAGTGGACTT

TGAGAAGCGAATTGAAGGCTCGGGAGATCAAGTAGACACACTAGAGTTGTCTGGTGGAGCCCGCATCAATCGTATCTTTCATGAGCGCTTTCCCTTTGAA

CTGGTAAAG - UNI32557 - ATGGAGTTTGATGAGAAAGATCTACGAAGAGAGATCAGCTATGCTATTAAGAACATCCACGGA GTTGG GACGGGG

CTCTTCACCCCCGACATGGCCTTTGAAGCCATCGTGAAAAAACAGCTTGTAAAACTCAAAGAGCCGAGTTTGAAGTGTGTTGACCTGGTGGTGTCGGAGC

TAGCCACGGTCATTAAAAAGTGTGCTGAGAAG - UNI8228 - CTGAGTTCCTACCCCCGGCTGCGAGAGGAGACCGAGCGAATTGTCACCACCTACA

TCAGGGAGCGAGAAGGGAGAACCAAGGACCAG ATTCTTCTTCTGATTGACATTGAGCAGTCGTACATCAACACAAACCATGAAGACTTCATTGGATTTG

CCAA TGCCCAGCAGAGGAGCACGCAGCTGAACAAGAAGAGGGCCATACCCAATCAG GGGGAGATCTTG - UNI25236 - GTGATCCGCAGGGGCT

GGTTGACCATCAACAATATCAGCTTGATGAAGGGTGGCTCCAAGGAGTACTGGTTCGTGCTGACAGCTGAGTCATTGTCTTGGTACAAGGATGAGGAG -

 UNI7660 - GAGAAAGAAAAGAAGTACATGCTGCCACTGGACAACCTCAAGATCCGGGACGTGGAAAAGGGCTTCATGTCCAACAAGCACGTGTTTGC

CATCTTCAACACAGAGCAGAG GAATGTCTACAAGGACCTTCGACAGATTGAACTGGCTTGTGACTCCCAGGAAGATGTGGACAGCTGGAAGGCTTCGTT

CCTGCGCGCTGGGGTCTACCCAGAGAAGGACCAG GCAGAGAATGAGGATGGAGCACAAGAGAACACCTTCTCCATGGACCCGCAGCTGGAGCGACAGGT

GGAGACCATCCGTAACCTGGTGGACTCCTACGTGGCCATCATCAACAAGTCCATCCGTGACCTTATGCCAAAGACCATCATGCACCTCATGATCAACAAC

 ACAAAGGCCTTCATCCACCATGAGCTGCTGGCTTACCTGTATTCATCAGCAGACCAGAGCAGCCTCATGGAAGAGTCAGCCGAGCAGGCTCAGCGGCGG

GACGACATGCTGCGCATGTACCACGCACTGAAGGAGGCCCTCAACATTATTGGGGACATCAGCACCAGCACCGTGTCCACACCCGTGCCCCCACCGGTCG

ATGACACGTGGCTCCAAAACACCAGCGGCCACAG CCCCACTCCACAGCGCCGACCTGTGTCCAGTGTGCACCCACCAGGCCGGCCACCTGCAGTGCGGG

GTCCTACACCGGGGCCTCCCCTGATTCCTATGCCTGTGGGGGCCACATCCTCCTTCTCAGCACCTCCCATCCCATCCCGGCCTGGACCACAGAGTGTGTT

TGCCAACAACGACCCCTTCTCTGCGCCACCTCAGATACCATCTCGGCCAGCACGGATTCCCCCTGGTATCCCTCCAGGAGTGCCCAG AAGAGCGCCCGC

TGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCGTCCCTGCTCGACTAG
Translation
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGR - UNI909 - RDFLPRGSGIVTRRPLILQLIFSKTE - UNI17

299 - EYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHV - UNI5748 - VLNLTLIDLPGITKVPVGDQPPDIEYQIKD

MILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQG GLRTIGVITKLDLMDEGTDARDVLENKLLPLRRG - UNI26333 - GYIGVVNRSQKD

IEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQ QLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQ QMVQQFGV

DFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVK - UNI32557 - MEFDEKDLRREISYAIKNIHG VG GTGLFTPDMAFEAIVKKQLVKLK

EPSLKCVDLVVSELATVIKKCAEK - UNI8228 - LSSYPRLREETERIVTTYIREREGRTKDQ ILLLIDIEQSYINTNHEDFIGFAN NAQQRSTQ

LNKKRAIPNQ GEIL - UNI25236 - VIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEE - UNI7660 - EKEKKYMLPLDNLKIRDVEK

GFMSNKHVFAIFNTEQR RNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQ AENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDL

MPKTIMHLMINN TKAFIHHELLAYLYSSADQSSLMEESAEQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQNTSGHS SPTPQRRP

VSSVHPPGRPPAVRGPTPGPPLIPMPVGATSSFSAPPIPSRPGPQSVFANNDPFSAPPQIPSRPARIPPGIPPGVPR RRAPAAPSRPTIIRPAEPSLLD

Transcript ENSMUST00000091087
Sequence
AGCGGGCGTCGCGGCGAAGGGGAGACCGGGCGGGCCGGCAGAGCAGAGCAGGAGGAAGCAACGGCCACAGACACATCGGAACCGAGAGTCTTAGTCGGGG

GATCCGCGCGGCGGAGGCGGACACCATGGGCAACCGCGGGATGGAAGAGCTCATCCCGCTGGTTAACAAGCTGCAGGACGCCTTCAGCTCCATCGGTCAG

AGCTGCCACCTGGACCTGCCGCAGATCGCCGTGGTGGGCGGCCAGAGCGCCGGCAAAAGTTCGGTGCTCGAGAACTTCGTGGGCCG - UNI909 - GG

ACTTCCTTCCACGAGGATCAGGAATTGTCACCCGGAGGCCTCTCATTCTGCAGCTCATCTTTTCCAAAACAG - UNI17299 - AATATGCGGAATTT

TTGCACTGCAAGTCCAAAAAATTTACAGACTTTGATGAAGTCCGGCAGGAGATCGAAGCAGAGACTGACCGGGTCACAGGCACCAACAAAGGCATCTCCC

CTGTGCCCATCAACCTTCGGGTCTACTCACCACACG - UNI5748 - TGTTGAACTTGACCCTCATCGACCTCCCAGGCATCACTAAGGTGCCGGTGG

GGGACCAGCCGCCAGACATCGAGTACCAGATCAAGGACATGATCCTGCAGTTCATCAGCCGCGAGAGCAGCCTCATTCTTGCCGTCACACCTGCCAACAT

GGACTTGGCCAACTCAGACGCCCTCAAGCTGGCCAAGGAGGTGGACCCCCAAG GCCTACGGACCATCGGTGTCATCACCAAGCTAGACTTGATGGATGA

AGGCACAGACGCCAGGGATGTCCTGGAAAACAAGCTACTGCCCTTGAGAAGAG - UNI26333 - GCTATATCGGCGTGGTTAACCGAAGCCAGAAAG

ACATCGAGGGCAAAAAGGACATCCGGGCTGCTCTGGCAGCCGAGAGGAAATTCTTCCTCTCCCACCCAGCCTACCGGCACATGGCTGACCGCATGGGCAC

CCCACACTTGCAGAAAACCCTGAACCAG CAACTGACCAACCACATCCGAGAGTCACTGCCGACCCTTCGCAGCAAGCTGCAGAGCCAACTGCTGTCCCT

GGAGAAGGAAGTGGAAGAGTACAAGAATTTCCGGCCTGATGACCCCACGCGCAAGACCAAAGCCCTGCTGCA GATGGTTCAGCAGTTTGGAGTGGACTT

TGAGAAGCGAATTGAAGGCTCGGGAGATCAAGTAGACACACTAGAGTTGTCTGGTGGAGCCCGCATCAATCGTATCTTTCATGAGCGCTTTCCCTTTGAA

CTGGTAAAG - UNI32557 - ATGGAGTTTGATGAGAAAGATCTACGAAGAGAGATCAGCTATGCTATTAAGAACATCCACGGAGTCAG AACTGGGC

TCTTCACGCCGGATTTGGCGTTCGAGGCCATTGTGAAAAAGCAGGTGGTCAAGCTGAAAGAGCCCTGTCTGAAATGCGTGGACCTGGTTATCCAGGAGCT

AATCAGTACAGTTAGGCAGTGCACCAGCAAG - UNI8228 - CTGAGTTCCTACCCCCGGCTGCGAGAGGAGACCGAGCGAATTGTCACCACCTACAT

CAGGGAGCGAGAAGGGAGAACCAAGGACCAG ATTCTTCTTCTGATTGACATTGAGCAGTCGTACATCAACACAAACCATGAAGACTTCATTGGATTTGC

CAA TGCCCAGCAGAGGAGCACGCAGCTGAACAAGAAGAGGGCCATACCCAATCAG - UNI25236 - GTGATCCGCAGGGGCTGGTTGACCATCAAC

AATATCAGCTTGATGAAGGGTGGCTCCAAGGAGTACTGGTTCGTGCTGACAGCTGAGTCATTGTCTTGGTACAAGGATGAGGAG - UNI7660 - GAG

AAAGAAAAGAAGTACATGCTGCCACTGGACAACCTCAAGATCCGGGACGTGGAAAAGGGCTTCATGTCCAACAAGCACGTGTTTGCCATCTTCAACACAG

AGCAGAG GAATGTCTACAAGGACCTTCGACAGATTGAACTGGCTTGTGACTCCCAGGAAGATGTGGACAGCTGGAAGGCTTCGTTCCTGCGCGCTGGGG

TCTACCCAGAGAAGGACCAG GCAGAGAATGAGGATGGAGCACAAGAGAACACCTTCTCCATGGACCCGCAGCTGGAGCGACAGGTGGAGACCATCCGTA

ACCTGGTGGACTCCTACGTGGCCATCATCAACAAGTCCATCCGTGACCTTATGCCAAAGACCATCATGCACCTCATGATCAACAAC ACAAAGGCCTTCA

TCCACCATGAGCTGCTGGCTTACCTGTATTCATCAGCAGACCAGAGCAGCCTCATGGAAGAGTCAGCCGAGCAGGCTCAGCGGCGGGACGACATGCTGCG

CATGTACCACGCACTGAAGGAGGCCCTCAACATTATTGGGGACATCAGCACCAGCACCGTGTCCACACCCGTGCCCCCACCGGTCGATGACACGTGGCTC

CAAAACACCAGCGGCCACAG CCCCACTCCACAGCGCCGACCTGTGTCCAGTGTGCACCCACCAGGCCGGCCACCTGCAGTGCGGGGTCCTACACCGGGG

CCTCCCCTGATTCCTATGCCTGTGGGGGCCACATCCTCCTTCTCAGCACCTCCCATCCCATCCCGGCCTGGACCACAGAGTGTGTTTGCCAACAACGACC

CCTTCTCTGCGCCACCTCAGATACCATCTCGGCCAGCACGGATTCCCCCTGGTATCCCTCCAGGAGTGCCCAG CAGAAGAGCGCCCGCTGCGCCCAGCC

GGCCCACCATTATCCGCCCAGCCGAGCCGTCCCTGCTCGACTAGGCTGCAGGGGGCAATGTTCTGGGGGGGTCCTCGTGCACCCACAGTGTAGGACAGTT

TTGGTGGTCTGGGCCCTGCTACTTGCCCTCCATGCTGGGACCAGGCTCCCCGTGGGCAAGCCCTGCCCTTTCCCTCCTCGCCCTAGTGGACATGACAATG

AAGGGTGAGGAGGCCCACAGCACAGCACATGGGGGCTTTGCACTTTGGGATGAGGAGGAGCTCTGGCTAGCAGAACAGGAACTGCATCCTTGGGACCATC

AGGAAAAAAAGGTCCAGGCTAGTGTGGGGGGACTCTTCTGGAGCTCCTCCAGAGCCTTTGTTCTTTCTGGGGTCCAGGAACTGCCCACCTTTCCTAAGGA

CTCCTCAGGAGTGAGCCAGGCCCAGCAGGTCCAGTGCTGACCCACCTGGCTCAAGTTGTATATATAGAGCTCCTTTGGCCATATTAACCACACAAGCTGA

GCCCAGCCCAGGCTCCGCACCCAGAGGTGCCTTTGTGCCTTCCTCAGGCCTGGAGGGCCTCAGCTCTGGCCACCCTCACTCTCCTCAGCCCCGGTTGTGG

TTTGGGCTGTATGAACTGGGGAGACATCAGAGGCCTCTTGGCTCCCAACCAGATGTCCCCACAGGGTGGGCCCTGGGTGCCTCTGCAGCCTCGGCTCCCA

CCGCCTGGATTGACCACTGTTAAGTGCCTGCCTCTGTATATCCTATTAATAAACTAAAATAAAGGG
Translation
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGR - UNI909 - RDFLPRGSGIVTRRPLILQLIFSKTE - UNI17

299 - EYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHV - UNI5748 - VLNLTLIDLPGITKVPVGDQPPDIEYQIKD

MILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQG GLRTIGVITKLDLMDEGTDARDVLENKLLPLRRG - UNI26333 - GYIGVVNRSQKD

IEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQ QLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQ QMVQQFGV

DFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVK - UNI32557 - MEFDEKDLRREISYAIKNIHGVR RTGLFTPDLAFEAIVKKQVVKLKE

PCLKCVDLVIQELISTVRQCTSK - UNI8228 - LSSYPRLREETERIVTTYIREREGRTKDQ ILLLIDIEQSYINTNHEDFIGFAN NAQQRSTQL

NKKRAIPNQ - UNI25236 - VIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEE - UNI7660 - EKEKKYMLPLDNLKIRDVEKGFMSNK

HVFAIFNTEQR RNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQ AENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIM

HLMINN TKAFIHHELLAYLYSSADQSSLMEESAEQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQNTSGHS SPTPQRRPVSSVHP

PGRPPAVRGPTPGPPLIPMPVGATSSFSAPPIPSRPGPQSVFANNDPFSAPPQIPSRPARIPPGIPPGVPS SRRAPAAPSRPTIIRPAEPSLLD
Transcript ENSMUST00000072362
Sequence
AGCGGGCGTCGCGGCGAAGGGGAGACCGGGCGGGCCGGCAGAGCAGAGCAGGAGGAAGCAACGGCCACAGACACATCGGAACCGAGAGTCTTAGTCGGGG

GATCCGCGCGGCGGAGGCGGACACCATGGGCAACCGCGGGATGGAAGAGCTCATCCCGCTGGTTAACAAGCTGCAGGACGCCTTCAGCTCCATCGGTCAG

AGCTGCCACCTGGACCTGCCGCAGATCGCCGTGGTGGGCGGCCAGAGCGCCGGCAAAAGTTCGGTGCTCGAGAACTTCGTGGGCCG - UNI909 - GG

ACTTCCTTCCACGAGGATCAGGAATTGTCACCCGGAGGCCTCTCATTCTGCAGCTCATCTTTTCCAAAACAG - UNI17299 - AATATGCGGAATTT

TTGCACTGCAAGTCCAAAAAATTTACAGACTTTGATGAAGTCCGGCAGGAGATCGAAGCAGAGACTGACCGGGTCACAGGCACCAACAAAGGCATCTCCC

CTGTGCCCATCAACCTTCGGGTCTACTCACCACACG - UNI5748 - TGTTGAACTTGACCCTCATCGACCTCCCAGGCATCACTAAGGTGCCGGTGG

GGGACCAGCCGCCAGACATCGAGTACCAGATCAAGGACATGATCCTGCAGTTCATCAGCCGCGAGAGCAGCCTCATTCTTGCCGTCACACCTGCCAACAT

GGACTTGGCCAACTCAGACGCCCTCAAGCTGGCCAAGGAGGTGGACCCCCAAG GCCTACGGACCATCGGTGTCATCACCAAGCTAGACTTGATGGATGA

AGGCACAGACGCCAGGGATGTCCTGGAAAACAAGCTACTGCCCTTGAGAAGAG - UNI26333 - GCTATATCGGCGTGGTTAACCGAAGCCAGAAAG

ACATCGAGGGCAAAAAGGACATCCGGGCTGCTCTGGCAGCCGAGAGGAAATTCTTCCTCTCCCACCCAGCCTACCGGCACATGGCTGACCGCATGGGCAC

CCCACACTTGCAGAAAACCCTGAACCAG CAACTGACCAACCACATCCGAGAGTCACTGCCGACCCTTCGCAGCAAGCTGCAGAGCCAACTGCTGTCCCT

GGAGAAGGAAGTGGAAGAGTACAAGAATTTCCGGCCTGATGACCCCACGCGCAAGACCAAAGCCCTGCTGCA GATGGTTCAGCAGTTTGGAGTGGACTT

TGAGAAGCGAATTGAAGGCTCGGGAGATCAAGTAGACACACTAGAGTTGTCTGGTGGAGCCCGCATCAATCGTATCTTTCATGAGCGCTTTCCCTTTGAA

CTGGTAAAG - UNI32557 - ATGGAGTTTGATGAGAAAGATCTACGAAGAGAGATCAGCTATGCTATTAAGAACATCCACGGAGTCAG AACTGGGC

TCTTCACGCCGGATTTGGCGTTCGAGGCCATTGTGAAAAAGCAGGTGGTCAAGCTGAAAGAGCCCTGTCTGAAATGCGTGGACCTGGTTATCCAGGAGCT

AATCAGTACAGTTAGGCAGTGCACCAGCAAG - UNI8228 - CTGAGTTCCTACCCCCGGCTGCGAGAGGAGACCGAGCGAATTGTCACCACCTACAT

CAGGGAGCGAGAAGGGAGAACCAAGGACCAG ATTCTTCTTCTGATTGACATTGAGCAGTCGTACATCAACACAAACCATGAAGACTTCATTGGATTTGC

CAA TGCCCAGCAGAGGAGCACGCAGCTGAACAAGAAGAGGGCCATACCCAATCAG GGGGAGATCTTG - UNI25236 - GTGATCCGCAGGGGCTG

GTTGACCATCAACAATATCAGCTTGATGAAGGGTGGCTCCAAGGAGTACTGGTTCGTGCTGACAGCTGAGTCATTGTCTTGGTACAAGGATGAGGAG - 

UNI7660 - GAGAAAGAAAAGAAGTACATGCTGCCACTGGACAACCTCAAGATCCGGGACGTGGAAAAGGGCTTCATGTCCAACAAGCACGTGTTTGCC

ATCTTCAACACAGAGCAGAG GAATGTCTACAAGGACCTTCGACAGATTGAACTGGCTTGTGACTCCCAGGAAGATGTGGACAGCTGGAAGGCTTCGTTC

CTGCGCGCTGGGGTCTACCCAGAGAAGGACCAG GCAGAGAATGAGGATGGAGCACAAGAGAACACCTTCTCCATGGACCCGCAGCTGGAGCGACAGGTG

GAGACCATCCGTAACCTGGTGGACTCCTACGTGGCCATCATCAACAAGTCCATCCGTGACCTTATGCCAAAGACCATCATGCACCTCATGATCAACAAC 

ACAAAGGCCTTCATCCACCATGAGCTGCTGGCTTACCTGTATTCATCAGCAGACCAGAGCAGCCTCATGGAAGAGTCAGCCGAGCAGGCTCAGCGGCGGG

ACGACATGCTGCGCATGTACCACGCACTGAAGGAGGCCCTCAACATTATTGGGGACATCAGCACCAGCACCGTGTCCACACCCGTGCCCCCACCGGTCGA

TGACACGTGGCTCCAAAACACCAGCGGCCACAG CCCCACTCCACAGCGCCGACCTGTGTCCAGTGTGCACCCACCAGGCCGGCCACCTGCAGTGCGGGG

TCCTACACCGGGGCCTCCCCTGATTCCTATGCCTGTGGGGGCCACATCCTCCTTCTCAGCACCTCCCATCCCATCCCGGCCTGGACCACAGAGTGTGTTT

GCCAACAACGACCCCTTCTCTGCGCCACCTCAGATACCATCTCGGCCAGCACGGATTCCCCCTGGTATCCCTCCAGGAGTGCCCAG CAGAAGAGCGCCC

GCTGCGCCCAGCCGGCCCACCATTATCCGCCCAGCCGAGCCGTCCCTGCTCGACTAGGCTGCAGGGGGCAATGTTCTGGGGGGGTCCTCGTGCACCCACA

GTGTAGGACAGTTTTGGTGGTCTGGGCCCTGCTACTTGCCCTCCATGCTGGGACCAGGCTCCCCGTGGGCAAGCCCTGCCCTTTCCCTCCTCGCCCTAGT

GGACATGACAATGAAGGGTGAGGAGGCCCACAGCACAGCACATGGGGGCTTTGCACTTTGGGATGAGGAGGAGCTCTGGCTAGCAGAACAGGAACTGCAT

CCTTGGGACCATCAGGAAAAAAAGGTCCAGGCTAGTGTGGGGGGACTCTTCTGGAGCTCCTCCAGAGCCTTTGTTCTTTCTGGGGTCCAGGAACTGCCCA

CCTTTCCTAAGGACTCCTCAGGAGTGAGCCAGGCCCAGCAGGTCCAGTGCTGACCCACCTGGCTCAAGTTGTATATATAGAGCTCCTTTGGCCATATTAA

CCACACAAGCTGAGCCCAGCCCAGGCTCCGCACCCAGAGGTGCCTTTGTGCCTTCCTCAGGCCTGGAGGGCCTCAGCTCTGGCCACCCTCACTCTCCTCA

GCCCCGGTTGTGGTTTGGGCTGTATGAACTGGGGAGACATCAGAGGCCTCTTGGCTCCCAACCAGATGTCCCCACAGGGTGGGCCCTGGGTGCCTCTGCA

GCCTCGGCTCCCACCGCCTGGATTGACCACTGTTAAGTGCCTGCCTCTGTATATCCTATTAATAAACTAAAATAAAGGG
Translation
MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLENFVGR - UNI909 - RDFLPRGSGIVTRRPLILQLIFSKTE - UNI17

299 - EYAEFLHCKSKKFTDFDEVRQEIEAETDRVTGTNKGISPVPINLRVYSPHV - UNI5748 - VLNLTLIDLPGITKVPVGDQPPDIEYQIKD

MILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQG GLRTIGVITKLDLMDEGTDARDVLENKLLPLRRG - UNI26333 - GYIGVVNRSQKD

IEGKKDIRAALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQ QLTNHIRESLPTLRSKLQSQLLSLEKEVEEYKNFRPDDPTRKTKALLQ QMVQQFGV

DFEKRIEGSGDQVDTLELSGGARINRIFHERFPFELVK - UNI32557 - MEFDEKDLRREISYAIKNIHGVR RTGLFTPDLAFEAIVKKQVVKLKE

PCLKCVDLVIQELISTVRQCTSK - UNI8228 - LSSYPRLREETERIVTTYIREREGRTKDQ ILLLIDIEQSYINTNHEDFIGFAN NAQQRSTQL

NKKRAIPNQ GEIL - UNI25236 - VIRRGWLTINNISLMKGGSKEYWFVLTAESLSWYKDEE - UNI7660 - EKEKKYMLPLDNLKIRDVEKG

FMSNKHVFAIFNTEQR RNVYKDLRQIELACDSQEDVDSWKASFLRAGVYPEKDQ AENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLM

PKTIMHLMINN TKAFIHHELLAYLYSSADQSSLMEESAEQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPPPVDDTWLQNTSGHS SPTPQRRPV

SSVHPPGRPPAVRGPTPGPPLIPMPVGATSSFSAPPIPSRPGPQSVFANNDPFSAPPQIPSRPARIPPGIPPGVPS SRRAPAAPSRPTIIRPAEPSLLD


For any suggestions or comments, please send an email to unitrap@crg.es