Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033342 (4833424O15Rik)
Chromosomal location
Chr 3: 117278379 - 117392424 (+)
Description
RIKEN cDNA 4833424O15 gene Gene [Source:MGI Symbol;Acc:MGI:1923019]
Human Ortholog
not available
Omim not available
UniTrap UNI37078
Vector Insertion
Chr 3: 117374953 - 117389533
Public Clones CMHD-GT_244A9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039564
Sequence
AGGGCAGATGGGACTCGTCCGGGGGTAGCCTCCTCCTCTGCATCCTGCCCGCGCATCCCGAAGCCCAGTCGCATCCTCCGCCTCTGCCTCGGCGGCTGCC

AGCCTCCGCCTCGCGCCACCTCGGCCTGCCGCCGCCCCCGCCGCCGCGCCCCCGGTGGCTGTGCCTCGGCGGAGCCCGGAGGGGGCCTGTGGCGCGTCGA

CCGCCCGCTCGGCTCGGCTTGGCCAGGAGGCGTGCATGCCCCTGCTGCCCGTGGCGCTCATCAGCAGCATGCTCTATTTCCAGATGGTGATCATGGCAGG

GACGGTGATGCTGGCTTACTACTTCGAATACACAGACACGTTCACTGTGAACGTGCAGGGATTCTTCTGCCACGACAGCGCCTACCGTAAGCCCTACCCG

GGCCCAGAGGACAGCAGCGCGGTGCCCCCGGTGCTCCTCTACTCGCTGGCCGCTGGCGTCCCGGTGCTTGTG ATAATAGTTGGAGAAACTGCAGTGTTT

TGCCTGCAATTAGCCACAAGAGATTTTGAAAACCAGGAAAAAACCATTTTAACTGGAGATTGTTGCTATATAAACCCACTGGTACGCCGAACCGTCCGAT

TTCTTG GAATTTATGCATTTGGACTGTTTGCTACAGATATCTTTGTAAATGCTGGGCAAGTGGTTACAGGAAACCTAGCTCCACACTTTCTGGCTTTGT

GTAAGCCAAACTACACAGCGCTCGGATGTCAGCAGTACACACAGTTTATCAGTGGGGAGGAAGCATGCACAGGCAACCCAGACCTCATCATGCGAGCACG

GAAAACATTCCCATCCAAGGAAGCTGCCCTGAGTGTCTACGCTGCCACGTATCTGACG ATGTACATTACCAGCACTATCAAAGCCAAAGGAACCAGACT

TGCTAAGCCTGTCCTGTGCTTGGGATTAATGTGTTTGGCCTTTCTTACTGGACTCAACAGAGTAGCGGAATATCGAAATCATTGGTCAGATGTGATAGCA

GGCTTCCTAGTCGGAATATCTATAGCAGTATTTCTG GTTGTATGCGTGGTAAACAATTTTAAAGGAAGACAACCAGAAAATGGGCATATACACAGGGAC

AATGTGGCCCGGATGCCAATGACCAACATTCCTCGAGTAGAAAGCCCTTTGGAAAAG - UNI37078 - AACCACGTCACTGCCTTTGCGGAAGTCAC

ATGATGTTGAAGCAGACGGTTTTTCCCTGCACTGGACATCATCCCTATTTACCATACATTCATAACAGAGTTTATTTGATTACACAGGAAATTTATAAAG

ATGTAGGACACTTTTTATAATTTTAAAACTTGACAGCACCCTCTCTGCCCCGCCCTCCCACGAGACTGTGAGCTCCTCAAGAGCAGGACCATGGCTTCCT

CTTCTGCATCCCCGCCACCCACGACAAAGCCCAGCACAAAGTGTGGGTGTTCAGTGAAAACACGATGATAAAACGAACAAGTCAACTCTTAAATAAAATG

GTTGCTTTAGTTTCTCAAAAAGAATCTCTGTGACTATGTGGAAAGAAACCCCCACATGGGTTATATTTGTATAAAAGAAACCCTCTATTTTGGGCTAGTT

AAGTCTTTTTAATTTTTCATATATCTATTCAGCAGTATAGCATATTTAATTTGAAGTGAATTTTGAAAGTTCTGGGGACTTTTTATTATGCAGCATGACA

TTATTTCCATTTTAACAGATTTCAGTGTGTGGAATCACTTTACTTTTAGAAAGTATGTCCTATACTAAATTGTTTGCTCATTATATTATGCTATATTTCA

CTTAAAACACCATTCATACTACATATTCTAAGACTGGTGCTTCTGCTTTTAAAGGGGAAAATGCCAATTTTTACTGTCACTGAGTAATGTATCATAATTA

AAATTATTTATTTGGACTTTTTCTTTGACAGTTGTGGTTTAATGGTTGTGCTGCAATTTTTTTTAATGCAGGCAATATTTAGAATACATTAAGGTAAATC

CAGCCATGATACCTTGTTATTGAGTAGCCTTCCATCATTAACAGTGTCTCAAAATGGCTATGGTCCATTATTAAATTTTCTAATTGGTCCAGAACTCAAA

TAATTTAAATGAGAAAGAACCACACCTTAAAATACTATCATGAAAATACTAGAAATATGATTAATGTATTTTTGTAATTGTCTAATACTTTAATTAAACG

TATTTATAGTTATCATTTAATCCTTATGGCAATCCTGTATAAATATTGAAAGATGACTTTATTTACATATGATAAAAATAAAGCCAAGACTGATAACATG

CCCAGTCCATACCACTAGTCAAGGGAAGAGTTAAATCTAAATTCAGATTTACCCTGAAACTCTTATTTTTCTCAAATATGCCACAGTTGCCTCAACATTC

ATGACACTGAGGCCATTAAGAGGCCATTAGGGTTCTGAGAAACTACCTATCTTTAAGAAAAAAAAATGAAGAAATGCTAAAGTTAGGAACAGAAGGTCTG

CAGTATTTTAAAAGCTTACTTACATGGAGGAACATAAAACATCTCTTTCAAACGCAGAGCTATTTAGGATTCTATTTATAATCCTATTTTAAAATAATGA

CATTCTAGTGTCTGAATGTGAGGCTTTTGGTAGAAGAGAGGTCCAAATGAAGATTCTCATCTCTGCATCTCAGCTACCTCTCAGGAAAGGGGCTGAGGGA

CAGGTTATACAGTGACCATGTAAGTTAAAGATGAAAACAGTCTCCACAGAAGAAGGAGGATCAAGTCATGAGTCACTCTGCAATCTCTAAGGCTAACCCA

AGATACTTTGACTTAAATGTGCAGAAAAATGATTTCTTTTAATCTTTCTAGTCTAAACATTTAGTTTGCTCTCTTAATTTCAACAGAAATCAGCAAATAA

TTAAAACCAAAGGCTTCTCTGTTACTTCCAAATGGATTTCAGTTGCCCAATTTCAATTCTGAAGAGGTCAAAATATGTCAACTGAAAGCCAAATTAAAAA

AAAATCTCATTTCTATGAATTGCAAATCTCTATAGCAGTTTTATTCTTTTGGAAATGTAGAGCAAACTTTGCATGTCTTGACAATCTTTAAAGACATTGT

TTAGAAAGCATTAGCAATGGCAAATTTGCTTCCTAGGATTGAAATAAAGGATATGACCATAATGCCAAGCAAAGGCAGGGTAGCTGACTAGGTCTATACA

GTTGCTCAAGGCTACTGGTCCTATACCCATTCAAAAGGACCCAGACGGGAGTGAATTTCCCCTTGGAGGCCTTAACATTACATAAGTCAGTGATAAAGTT

TTTCACCTTCCTAAACCTGGTCAGATTAAAAGAGTTATAAATTAAAGAACTAATCAGGGTCAAAGTTAAATCACTTCTGCTATTACATTTAAGCATCATG

AACCCAAGGTTGTACAATGATAAAGTCCAGGAAAAAATTAAAGATGCATGCGAATTAACCAAACTCAGCCAAGAGTGCTTAACCATGATGCAACTACTTA

GAACTATTTTAAAATTTATACCTTTCAGAAAACGTCAGAACAATGGCTGGAGCTGGAATTCAGTGGTACGGCACTTGCCTAGCATGCACAGGCCCTGGGT

TCAATCCCTAGGACCTGTATAAGAAAGCACTAATATCAATATATAAATATGTACATACATAGTAAAAGCAGGCAATCACATGCCTTTCCGATAGAGACTC

TCATTTTTATTCTGCTTCTTTGGGGCCCAGGTCAACGTAAATTGTTCAAGATGAAAACTTCAGTAGTATCTGTTTGCATGGCAGAAGTTCTGCACAAGTC

TTATCCGATGATGCCTAAGGTAACTTAAAAGGCTCTTTTATGTTAAAAGAGAGGTGAGCCTTCTTTGATAGAGTTTGTCTATTCGACTTCTAACTGGGCC

TCTCTTTTTCTCAGGATCTATCCTAGCCAAATATCTCGTTACATTTCCACAGTTTTCTTTGTGAAAGAACAGTGGGGGAGGAAAGAATTCTCTGCTGTGT

ATTGTATTTTTCAAATAAAAAATTAAAAACTAAATTAAAAAAAATAAATTTCTTTTTCCCTC
Translation
MPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLV IIVGETAVFCLQLATRDFEN

QEKTILTGDCCYINPLVRRTVRFLG GIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAA

LSVYAATYLT MYITSTIKAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFL VVCVVNNFKGRQPENGHIHRDNVARMPMT

NIPRVESPLEK - UNI37078 - NHVTAFAEVT
Transcript ENSMUST00000106473
Sequence
AGGGCAGATGGGACTCGTCCGGGGGTAGCCTCCTCCTCTGCATCCTGCCCGCGCATCCCGAAGCCCAGTCGCATCCTCCGCCTCTGCCTCGGCGGCTGCC

AGCCTCCGCCTCGCGCCACCTCGGCCTGCCGCCGCCCCCGCCGCCGCGCCCCCGGTGGCTGTGCCTCGGCGGAGCCCGGAGGGGGCCTGTGGCGCGTCGA

CCGCCCGCTCGGCTCGGCTTGGCCAGGAGGCGTGCATGCCCCTGCTGCCCGTGGCGCTCATCAGCAGCATGCTCTATTTCCAGATGGTGATCATGGCAGG

GACGGTGATGCTGGCTTACTACTTCGAATACACAGACACGTTCACTGTGAACGTGCAGGGATTCTTCTGCCACGACAGCGCCTACCGTAAGCCCTACCCG

GGCCCAGAGGACAGCAGCGCGGTGCCCCCGGTGCTCCTCTACTCGCTGGCCGCTGGCGTCCCGGTGCTTGTG ATAATAGTTGGAGAAACTGCAGTGTTT

TGCCTGCAATTAGCCACAAGAGATTTTGAAAACCAGGAAAAAACCATTTTAACTGGAGATTGTTGCTATATAAACCCACTGGTACGCCGAACCGTCCGAT

TTCTTG GAATTTATGCATTTGGACTGTTTGCTACAGATATCTTTGTAAATGCTGGGCAAGTGGTTACAGGAAACCTAGCTCCACACTTTCTGGCTTTGT

GTAAGCCAAACTACACAGCGCTCGGATGTCAGCAGTACACACAGTTTATCAGTGGGGAGGAAGCATGCACAGGCAACCCAGACCTCATCATGCGAGCACG

GAAAACATTCCCATCCAAGGAAGCTGCCCTGAGTGTCTACGCTGCCACGTATCTGACG ATGTACATTACCAGCACTATCAAAGCCAAAGGAACCAGACT

TGCTAAGCCTGTCCTGTGCTTGGGATTAATGTGTTTGGCCTTTCTTACTGGACTCAACAGAGTAGCGGAATATCGAAATCATTGGTCAGATGTGATAGCA

GGCTTCCTAGTCGGAATATCTATAGCAGTATTTCTG GTTGTATGCGTGGTAAACAATTTTAAAGGAAGACAACCAGAAAATGGGCATATACACAGGGAC

AATGTGGCCCGGATGCCAATGACCAACATTCCTCGAGTAGAAAGCCCTTTGGAAAAGGTAACATCTCTGCAG - UNI37078 - AACCACGTCACTGC

CTTTGCGGAAGTCACATGATGTTGAAGCAGACGGTTTTTCCCTGCACTGGACATCATCCCTATTTACCATACATTCATAACAGAGTTTATTTGATTACAC

AGGAAATTTATAAAGATGTAGGACACTTTTTATAATTTTAAAACTTGACAGCACCCTCTCTGCCCCGCCCTCCCACGAGACTGTGAGCTCCTCAAGAGCA

GGACCATGGCTTCCTCTTCTGCATCCCCGCCACCCACGACAAAGCCCAGCACAAAGTGTGGGTGTTCAGTGAAAACACGATGATAAAACGAACAAGTCAA

CTCTTAAATAAAATGGTTGCTTTAGTTTCTCAAAAAGAATCTCTGTGACTATGTGGAAAGAAACCCCCACATGGGTTATATTTGTATAAAAGAAACCCTC

TATTTTGGGCTAGTTAAGTCTTTTTAATTTTTCATATATCTATTCAGCAGTATAGCATATTTAATTTGAAGTGAATTTTGAAAGTTCTGGGGACTTTTTA

TTATGCAGCATGACATTATTTCCATTTTAACAGATTTCAGTGTGTGGAATCACTTTACTTTTAGAAAGTATGTCCTATACTAAATTGTTTGCTCATTATA

TTATGCTATATTTCACTTAAAACACCATTCATACTACATATTCTAAGACTGGTGCTTCTGCTTTTAAAGGGGAAAATGCCAATTTTTACTGTCACTGAGT

AATGTATCATAATTAAAATTATTTATTTGGACTTTTTCTTTGACAGTTGTGGTTTAATGGTTGTGCTGCAATTTTTTTTAATGCAGGCAATATTTAGAAT

ACATTAAGGTAAATCCAGCCATGATACCTTGTTATTGAGTAGCCTTCCATCATTAACAGTGTCTCAAAATGGCTATGGTCCATTATTAAATTTTCTAATT

GGTCCAGAACTCAAATAATTTAAATGAGAAAGAACCACACCTTAAAATACTATCATGAAAATACTAGAAATATGATTAATGTATTTTTGTAATTGTCTAA

TACTTTAATTAAACGTATTTATAGTTATCATTTAATCCTTATGGCAATCCTGTATAAATATTGAAAGATGACTTTATTTACATATGATAAAAATAAAGCC

AAGACTGATAACATGCCCAGTCCATACCACTAGTCAAGGGAAGAGTTAAATCTAAATTCAGATTTACCCTGAAACTCTTATTTTTCTCAAATATGCCACA

GTTGCCTCAACATTCATGACACTGAGGCCATTAAGAGGCCATTAGGGTTCTGAGAAACTACCTATCTTTAAGAAAAAAAAATGAAGAAATGCTAAAGTTA

GGAACAGAAGGTCTGCAGTATTTTAAAAGCTTACTTACATGGAGGAACATAAAACATCTCTTTCAAACGCAGAGCTATTTAGGATTCTATTTATAATCCT

ATTTTAAAATAATGACATTCTAGTGTCTGAATGTGAGGCTTTTGGTAGAAGAGAGGTCCAAATGAAGATTCTCATCTCTGCATCTCAGCTACCTCTCAGG

AAAGGGGCTGAGGGACAGGTTATACAGTGACCATGTAAGTTAAAGATGAAAACAGTCTCCACAGAAGAAGGAGGATCAAGTCATGAGTCACTCTGCAATC

TCTAAGGCTAACCCAAGATACTTTGACTTAAATGTGCAGAAAAATGATTTCTTTTAATCTTTCTAGTCTAAACATTTAGTTTGCTCTCTTAATTTCAACA

GAAATCAGCAAATAATTAAAACCAAAGGCTTCTCTGTTACTTCCAAATGGATTTCAGTTGCCCAATTTCAATTCTGAAGAGGTCAAAATATGTCAACTGA

AAGCCAAATTAAAAAAAAATCTCATTTCTATGAATTGCAAATCTCTATAGCAGTTTTATTCTTTTGGAAATGTAGAGCAAACTTTGCATGTCTTGACAAT

CTTTAAAGACATTGTTTAGAAAGCATTAGCAATGGCAAATTTGCTTCCTAGGATTGAAATAAAGGATATGACCATAATGCCAAGCAAAGGCAGGGTAGCT

GACTAGGTCTATACAGTTGCTCAAGGCTACTGGTCCTATACCCATTCAAAAGGACCCAGACGGGAGTGAATTTCCCCTTGGAGGCCTTAACATTACATAA

GTCAGTGATAAAGTTTTTCACCTTCCTAAACCTGGTCAGATTAAAAGAGTTATAAATTAAAGAACTAATCAGGGTCAAAGTTAAATCACTTCTGCTATTA

CATTTAAGCATCATGAACCCAAGGTTGTACAATGATAAAGTCCAGGAAAAAATTAAAGATGCATGCGAATTAACCAAACTCAGCCAAGAGTGCTTAACCA

TGATGCAACTACTTAGAACTATTTTAAAATTTATACCTTTCAGAAAACGTCAGAACAATGGCTGGAGCTGGAATTCAGTGGTACGGCACTTGCCTAGCAT

GCACAGGCCCTGGGTTCAATCCCTAGGACCTGTATAAGAAAGCACTAATATCAATATATAAATATGTACATACATAGTAAAAGCAGGCAATCACATGCCT

TTCCGATAGAGACTCTCATTTTTATTCTGCTTCTTTGGGGCCCAGGTCAACGTAAATTGTTCAAGATGAAAACTTCAGTAGTATCTGTTTGCATGGCAGA

AGTTCTGCACAAGTCTTATCCGATGATGCCTAAGGTAACTTAAAAGGCTCTTTTATGTTAAAAGAGAGGTGAGCCTTCTTTGATAGAGTTTGTCTATTCG

ACTTCTAACTGGGCCTCTCTTTTTCTCAGGATCTATCCTAGCCAAATATCTCGTTACATTTCCACAGTTTTCTTTGTGAAAGAACAGTGGGGGAGGAAAG

AATTCTCTGCTGTGTATTGTATTTTTCAAATAAAAAATTAAAAACTAAATTAAAAAAAATAAATTTCTTTTTCCCTC
Translation
MPLLPVALISSMLYFQMVIMAGTVMLAYYFEYTDTFTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLV IIVGETAVFCLQLATRDFEN

QEKTILTGDCCYINPLVRRTVRFLG GIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAA

LSVYAATYLT MYITSTIKAKGTRLAKPVLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAVFL VVCVVNNFKGRQPENGHIHRDNVARMPMT

NIPRVESPLEKVTSLQ - UNI37078 - NHVTAFAEVT

For any suggestions or comments, please send an email to unitrap@crg.es