Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033364 (Usp37)
Chromosomal location
Chr 1: 74485686 - 74590860 (-)
Description
ubiquitin specific peptidase 37 Gene [Source:MGI Symbol;Acc:MGI:2442483]
RefSeq_dna
NM_176972 
RefSeq_peptide
NP_795946.1 
MGI
MGI:2442483 
Uniprot/SWISSPROT
Q8C0R0 
Uniprot/SPTREMBL
B2RT12 
Human Ortholog
ENSG00000135913 (USP37)
Omim not available
UniTrap UNI32411
Vector Insertion
Chr 1: 74577636 - 74590861
Public Clones IST12362F4 (tigm) IST14214A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19789
Vector Insertion
Chr 1: 74546675 - 74577636
Public Clones (sanger) P123H01 (ggtc) D170B11 (ggtc) H003F07 (ggtc) D170C11 (ggtc)
IST14151D3 (tigm) IST14505B12 (tigm) IST14471B11 (tigm)
Private Clones OST380430 (lexicon) OST309763 (lexicon) OST300338 (lexicon) OST137704 (lexicon)
OST120254 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11471
Vector Insertion
Chr 1: 74542428 - 74546529
Public Clones A006E01 (ggtc)
Private Clones OST312108 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15778
Vector Insertion
Chr 1: 74536765 - 74539478
Public Clones not available
Private Clones OST499993 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9531
Vector Insertion
Chr 1: 74526324 - 74532554
Public Clones RRA128 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 24% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34857
Vector Insertion
Chr 1: 74508139 - 74513569
Public Clones IST13320H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30467
Vector Insertion
Chr 1: 74500658 - 74502652
Public Clones CMHD-GT_258A01-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38709
Vector Insertion
Chr 1: 74497068 - 74499428
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8827
Vector Insertion
Chr 1: 74491103 - 74497068
Public Clones TEA217 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055335
Sequence
AGTGTCTGAAAGGAAGGATGGTTACAACGGATGCAGGTGCAGTGGGGCGAGAAGAAACAGAGGATCTGGGAGAGGGGGCACCAGCAAGGACACAAAGGAT

AAAATTCTAAAA - UNI32411 - GTACAGAAGCCAGGAGTGAGGTTCTGCCTGTGCAAGAGACACTTTATCAG - UNI19789 - - UNI32411

 - CTGAGTTGATGACTGCTGGAGGGACCACTGGTAGAGCCGAAGAATATGAATAGTTTCTCAAGAAAAGTACATTACTTTTGGCACAAGAAGCAGAATA

ACTGTGAATTGTTATCACGTGGAATTTTTCAGTAAAAATCACTGAAAA - UNI11471 - AATTCGTCAGGTGAACATATATTTTTGCTTTTTAATTT

GGTTAAAAGCAATTTATTTTTAAAGAAACTATGTCTCCCCTGAAGATCTATGGTCCTATCAGAATTCGAAGCATGCAGACTGGGATTACAAAGTGGAAAG

AAGGGTCCTTTGAAATTGTGGAAAAAGACAATAGAGTCAGCCTGCTCGTTCACTACAACACTGGAGGAATTCCAAGAGTGTTTCAG CTAAGTCATAACA

TTAAAAATGTGGTACTACGACCCAGTGGAATAAAACAAAGCCGCCTAATGTTGACTTTACAAGATAACAGCTTCTTGTCTATTGACAAAGTACCAAGTAA

GGATGCAGAGGAAATGAGGTTGTTCCTAGATGCCGTCCATCAAAACAGACTTCATGCAG - UNI15778 - CTATGAAAGCTTCTCAAGGTTCTGGTA

GTTTTGGAACTATTCTGGGCAGCAGGACCTCTCAGAAGGAAACTAACAGACAGCTTTCTTACTCAGACAATCAG GCCTCTTCAAAAAGAGGAAGTTTAG

AAACTAAAGATGAAATTCCATTTCGAAAAGTTCTTGGCAGTCCTGGTAGAGGACCAATTAAGACTGTAACTGGAGGTGGAATGGCTGTTACCCGGACTAT

TCCTTCTTTGACGCTGACATCAACACCTCTTAGATCAGGATTATTAGAAAACCG CACTGAAAAGAGGAAAAGAATGTTATCTGGTTCAGAGCTGACTGA

AGATTACCCTAAGGAAAATGACTCATCATC - UNI9531 - GAACAACAAAGCTATGACAGACCCTTCAAGAAAATATTTAACCAGCTGTAGAGAAAA

GCAGCTGAGTTTGAAACAGGCAGAAGAAAATCGAACATCAG GGCTTTTACCTCTGCAGTCATCCTCATTCTATGGGAGCAGAGCTGGATCAAAGGACTA

CTCTTCTGGTGTCACTAACCTGGACAG GTGTAATGTTTCAAGCCAGACTCCTTCTGCCAAAAGAAGCCTGGGGTTTCTTCCTCAGCCAACTCCTCTGTC

TGTTAAAAAACTGAGGTGTAACCAGGATTACGCGGGCTGGAACAGACCTAGAGTGCCCCTTTCCTCCCATCAACAGCAGCTGCAGGG ATTCTCCAACTT

GGGAAATACATGCTATATGAATGCTATCTTACAATCTCTGTTTTCACTCCAGTCATTTGCAAATGATTTGCTTAAACAAAGTATCCCATGGAAGAAAATT

CCATTCAATGCACTTATCAG ACGCTTTGCAAACCTGCTTATTAAAAAAGATATTTGTAATTCAGAGACCAAAAAAGAACTACTTAAGAAGGTTAAAAAT

GCTATTTCAGCTACTGCAGAGAGATTCTCTGGCTATGTCCAAAAT GATGCTCATGAATTTTTAAGTCAGTGCTTAGATCAGCTAAAGGAGGATATGGAA

AAACTGAATAAAACTTGGAAGACAGAACCTGTCCTTGGAGAAGAAAATTTGCCAGATACATCAGCTACCAAAGTGTTCACGTGCCCTGTTATTACAAACT

TGGAGTTTGAAGTTCAGCACTCCATTATCTGTAAAGC ATGTGGAGAAACTATTCCCAAAAGAGAACAGTTCAATGACCTCTCCATTGACCTTCCTCGGA

GGAAAAAGCCACTCCCTCCTCGTTCAATCCAAGATTCTCTCGATCTTTTCTTTAGG - UNI34857 - GCAGAAGAACTTGAATACTCATGTGAAAAG

TGTGGTGGAAAATGTGCTCTTGTCAGGCACAAATTTAACAGGCTGCCCAG - UNI34857 - GGTCCTCATCCTTCATTTGAAGCGATACAGCTTCAA

TGTGGCTCTCTCACTTAACAACAAGCTCGGACAGCAAGTCATCATCCCAAGATTCCTGACCCTGGCCTCCCACTGCACTGAGAGCACAAAGCCGCCGGTC

ACCCTTGGGTGGAGCGCACCCGTGGCAAT - UNI34857 - GAAATTCACCTTCAAATCCAAGAGCTCCGTGACATCATGCCTTGATTCAGACAGTGA

GGATGAACTTAAACGCTCTGTGGTCCTCAGTCAGAGACTTTGTGATTTGCCAGGCAATGAACAGTACCAGGAAGATGTGGAAAAA - UNI30467 - G

ATTTGAAATTGTGCAGATTAGAGCCTGGGAAGGCAGAACTGGAGAACTCAGGATTTGACAGAATGAGTGAGGAAGAGGTGCTGGCAGCTGTGTTAGAGAT

AAGCAGGAGAGAAGCTTCGCCGGTACTTAGCCCTGAAGATGATGATAAGCCAACCAGCAGTCCGGACACCGGCTTTGCAGAAGATGATATTCCAGAAATG

CCTGAAAATCCAGATGCTATGGAAATTGAGAAGTCCAAAACAATCACTGAGCCAG GTCCTGCTAGTTTTACTGAGATAACAAAAGACTGTGATGAGAAT

AAAGAAAACAAAACTCCAGAAGGCTCTCAGGGAGAGGTTGATTGGCTCCAGCAGTATGACGTAGACCGGGAAAGAGAAGAGCAGGAGCTGCAGCAAGCAC

TGGCTCAGAGCCTTCAAGAGCAA GAGGCTTGGGAACAGAAGGAAGATGACGACCTCAAAAGGGCTACAGAATTAAGTCTTCAAG - UNI8827 - AG

TTTAACAACTCTTTTCTGGATTCCCTGGGCTCAGATGAGGACTCTGGAAATGAGGATGTTTTTGATATGGAGTACACAGAAGCTGAAGCTGAGGAGCTGA

AAAGAAATGCTGAG ACAGGAGCTCTTCCTCATTCCTATCGGCTCATCAGTGTTGTCAGTCACATTGGGAGCACTTCTTCCTCAG GTCATTACATTAGT

GATGTGTATGACATTAAGAAACAGGCATGGTTCACTTACAATGACCTGGAGGTCTCTAAAATCCAAGAGGCTGCCGTGCAGAGTGATCGAGATCGCAGCG

GCTATATCTTCTTCTATATGCACAA GGAGATCTTTGATGAGTTGCTGGAGACAGAAAAAACCTCTCAGGCGCTTAGCATGGAGGTGGGGAGAGCTGCCC

GTCAGGCTTCATGAGGAGAACCTCGTGGGCGTCAGCACAAGCTGCACGTCTGTCACTGCCACCCTCCTTGACGTCCTCTGCCCGAAGAGAATTGGGAACT

CTACTTGATGCAGGAGCAACAACAGCTCAGGGCCAAACCAAAAGAAACTTCAGTCATGTGCAACGCTCCATGCTGTTTTATGGAAACCTTGGTCGCATCT

ATAGCTGATTATCCTCTTTTTCTTCTACAAGAGTGCCGCTTCCTTTTGTCTTAGGAATGAATACATACTGTAAATATATATGTACATACCCAC
Translation
 - UNI32411 -  - UNI19789 - - UNI32411 -  - UNI11471 - MSPLKIYGPIRIRSMQTGITKWKEGSFEIVEKDNRVSLLVHYNTG

GIPRVFQ LSHNIKNVVLRPSGIKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLHAA - UNI15778 - AMKASQGSGSFGTILGSRTS

QKETNRQLSYSDNQ ASSKRGSLETKDEIPFRKVLGSPGRGPIKTVTGGGMAVTRTIPSLTLTSTPLRSGLLENR RTEKRKRMLSGSELTEDYPKENDS

SS - UNI9531 - SNNKAMTDPSRKYLTSCREKQLSLKQAEENRTSG GLLPLQSSSFYGSRAGSKDYSSGVTNLDR RCNVSSQTPSAKRSLGFLPQ

PTPLSVKKLRCNQDYAGWNRPRVPLSSHQQQLQG GFSNLGNTCYMNAILQSLFSLQSFANDLLKQSIPWKKIPFNALIR RRFANLLIKKDICNSETKK

ELLKKVKNAISATAERFSGYVQN DAHEFLSQCLDQLKEDMEKLNKTWKTEPVLGEENLPDTSATKVFTCPVITNLEFEVQHSIICKA ACGETIPKREQ

FNDLSIDLPRRKKPLPPRSIQDSLDLFFR - UNI34857 - AEELEYSCEKCGGKCALVRHKFNRLPR - UNI34857 - RVLILHLKRYSFNVAL

SLNNKLGQQVIIPRFLTLASHCTESTKPPVTLGWSAPVAM - UNI34857 - MKFTFKSKSSVTSCLDSDSEDELKRSVVLSQRLCDLPGNEQYQEDV

EK - UNI30467 - DLKLCRLEPGKAELENSGFDRMSEEEVLAAVLEISRREASPVLSPEDDDKPTSSPDTGFAEDDIPEMPENPDAMEIEKSKTITE

PG GPASFTEITKDCDENKENKTPEGSQGEVDWLQQYDVDREREEQELQQALAQSLQEQ EAWEQKEDDDLKRATELSLQE - UNI8827 - EFNNSF

LDSLGSDEDSGNEDVFDMEYTEAEAEELKRNAE TGALPHSYRLISVVSHIGSTSSSG GHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYI

FFYMHK KEIFDELLETEKTSQALSMEVGRAARQAS
Transcript ENSMUST00000044260
Sequence
AGTGTCTGAAAGGAAGGATGGTTACAACGGATGCAGGTGCAGTGGGGCGAGAAGAAACAGAGGATCTGGGAGAGGGGGCACCAGCAAGGACACAAAGGAT

AAAATTCTAAAA - UNI32411 - GTACAGAAGCCAGGAGTGAGGTTCTGCCTGTGCAAGAGACACTTTATCAG - UNI19789 - - UNI32411

 - CTGAGTTGATGACTGCTGGAGGGACCACTGGTAGAGCCGAAGAATATGAATAGTTTCTCAAGAAAAGTACATTACTTTTGGCACAAGAAGCAGAATA

ACTGTGAATTGTTATCACGTGGAATTTTTCAGTAAAAATCACTGAAAA - UNI11471 - AATTCGTCAGGTGAACATATATTTTTGCTTTTTAATTT

GGTTAAAAGCAATTTATTTTTAAAGAAACTATGTCTCCCCTGAAGATCTATGGTCCTATCAGAATTCGAAGCATGCAGACTGGGATTACAAAGTGGAAAG

AAGGGTCCTTTGAAATTGTGGAAAAAGACAATAGAGTCAGCCTGCTCGTTCACTACAACACTGGAGGAATTCCAAGAGTGTTTCAG CTAAGTCATAACA

TTAAAAATGTGGTACTACGACCCAGTGGAATAAAACAAAGCCGCCTAATGTTGACTTTACAAGATAACAGCTTCTTGTCTATTGACAAAGTACCAAGTAA

GGATGCAGAGGAAATGAGGTTGTTCCTAGATGCCGTCCATCAAAACAGACTTCATGCAG - UNI15778 - CTATGAAAGCTTCTCAAGGTTCTGGTA

GTTTTGGAACTATTCTGGGCAGCAGGACCTCTCAGAAGGAAACTAACAGACAGCTTTCTTACTCAGACAATCAG GCCTCTTCAAAAAGAGGAAGTTTAG

AAACTAAAGATGAAATTCCATTTCGAAAAGTTCTTGGCAGTCCTGGTAGAGGACCAATTAAGACTGTAACTGGAGGTGGAATGGCTGTTACCCGGACTAT

TCCTTCTTTGACGCTGACATCAACACCTCTTAGATCAGGATTATTAGAAAACCG CACTGAAAAGAGGAAAAGAATGTTATCTGGTTCAGAGCTGACTGA

AGATTACCCTAAGGAAAATGACTCATCATC - UNI9531 - GAACAACAAAGCTATGACAGACCCTTCAAGAAAATATTTAACCAGCTGTAGAGAAAA

GCAGCTGAGTTTGAAACAGGCAGAAGAAAATCGAACATCAG GGCTTTTACCTCTGCAGTCATCCTCATTCTATGGGAGCAGAGCTGGATCAAAGGACTA

CTCTTCTGGTGTCACTAACCTGGACAG GTGTAATGTTTCAAGCCAGACTCCTTCTGCCAAAAGAAGCCTGGGGTTTCTTCCTCAGCCAACTCCTCTGTC

TGTTAAAAAACTGAGGTGTAACCAGGATTACGCGGGCTGGAACAGACCTAGAGTGCCCCTTTCCTCCCATCAACAGCAGCTGCAGGG ATTCTCCAACTT

GGGAAATACATGCTATATGAATGCTATCTTACAATCTCTGTTTTCACTCCAGTCATTTGCAAATGATTTGCTTAAACAAAGTATCCCATGGAAGAAAATT

CCATTCAATGCACTTATCAG ACGCTTTGCAAACCTGCTTATTAAAAAAGATATTTGTAATTCAGAGACCAAAAAAGAACTACTTAAGAAGGTTAAAAAT

GCTATTTCAGCTACTGCAGAGAGATTCTCTGGCTATGTCCAAAAT GATGCTCATGAATTTTTAAGTCAGTGCTTAGATCAGCTAAAGGAGGATATGGAA

AAACTGAATAAAACTTGGAAGACAGAACCTGTCCTTGGAGAAGAAAATTTGCCAGATACATCAGCTACCAAAGTGTTCACGTGCCCTGTTATTACAAACT

TGGAGTTTGAAGTTCAGCACTCCATTATCTGTAAAGC ATGTGGAGAAACTATTCCCAAAAGAGAACAGTTCAATGACCTCTCCATTGACCTTCCTCGGA

GGAAAAAGCCACTCCCTCCTCGTTCAATCCAAGATTCTCTCGATCTTTTCTTTAGG - UNI34857 - GCAGAAGAACTTGAATACTCATGTGAAAAG

TGTGGTGGAAAATGTGCTCTTGTCAGGCACAAATTTAACAGGCTGCCCAG - UNI34857 - GGTCCTCATCCTTCATTTGAAGCGATACAGCTTCAA

TGTGGCTCTCTCACTTAACAACAAGCTCGGACAGCAAGTCATCATCCCAAGATTCCTGACCCTGGCCTCCCACTGCACTGAGAGCACAAAGCCGCCGGTC

ACCCTTGGGTGGAGCGCACCCGTGGCAAT - UNI34857 - TTCTAGACCATTGAGAGCCTGTCAAATGGTGAATTCCTGCATCACCAGCCCTTCTGC

ACCTTCAAA GAAATTCACCTTCAAATCCAAGAGCTCCGTGACATCATGCCTTGATTCAGACAGTGAGGATGAACTTAAACGCTCTGTGGTCCTCAGTCA

GAGACTTTGTGATTTGCCAGGCAATGAACAGTACCAGGAAGATGTGGAAAAA - UNI30467 - GATTTGAAATTGTGCAGATTAGAGCCTGGGAAGG

CAGAACTGGAGAACTCAGGATTTGACAGAATGAGTGAGGAAGAGGTGCTGGCAGCTGTGTTAGAGATAAGCAGGAGAGAAGCTTCGCCGGTACTTAGCCC

TGAAGATGATGATAAGCCAACCAGCAGTCCGGACACCGGCTTTGCAGAAGATGATATTCCAGAAATGCCTGAAAATCCAGATGCTATGGAAATTGAGAAG

TCCAAAACAATCACTGAGCCAG GTCCTGCTAGTTTTACTGAGATAACAAAAGACTGTGATGAGAATAAAGAAAACAAAACTCCAGAAGGCTCTCAGGGA

GAGGTTGATTGGCTCCAGCAGTATGACGTAGACCGGGAAAGAGAAGAGCAGGAGCTGCAGCAAGCACTGGCTCAGAGCCTTCAAGAGCAA GAGGCTTGG

GAACAGAAGGAAGATGACGACCTCAAAAGGGCTACAGAATTAAGTCTTCAAG - UNI8827 - AGTTTAACAACTCTTTTCTGGATTCCCTGGGCTCA

GATGAGGACTCTGGAAATGAGGATGTTTTTGATATGGAGTACACAGAAGCTGAAGCTGAGGAGCTGAAAAGAAATGCTGAG ACAGGAGCTCTTCCTCAT

TCCTATCGGCTCATCAGTGTTGTCAGTCACATTGGGAGCACTTCTTCCTCAG GTCATTACATTAGTGATGTGTATGACATTAAGAAACAGGCATGGTTC

ACTTACAATGACCTGGAGGTCTCTAAAATCCAAGAGGCTGCCGTGCAGAGTGATCGAGATCGCAGCGGCTATATCTTCTTCTATATGCACAA GGAGATC

TTTGATGAGTTGCTGGAGACAGAAAAAACCTCTCAGGCGCTTAGCATGGAGGTGGGGAGAGCTGCCCGTCAGGCTTCATGAGGAGAACCTCGTGGGCGTC

AGCACAAGCTGCACGTCTGTCACTGCCACCCTCCTTGACGTCCTCTGCCCGAAGAGAATTGGGAACTCTACTTGATGCAGGAGCAACAACAGCTCAGGGC

CAAACCAAAAGAAACTTCAGTCATGTGCAACGCTCCATGCTGTTTTATGGAAACCTTGGTCGCATCTATAGCTGATTATCCTCTTTTTCTTCTACAAGAG

TGCCGCTTCCTTTTGTCTTAGGAATGAATACATACTGTAAATATATATGTACATACCCAC
Translation
 - UNI32411 -  - UNI19789 - - UNI32411 -  - UNI11471 - MSPLKIYGPIRIRSMQTGITKWKEGSFEIVEKDNRVSLLVHYNTG

GIPRVFQ LSHNIKNVVLRPSGIKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLHAA - UNI15778 - AMKASQGSGSFGTILGSRTS

QKETNRQLSYSDNQ ASSKRGSLETKDEIPFRKVLGSPGRGPIKTVTGGGMAVTRTIPSLTLTSTPLRSGLLENR RTEKRKRMLSGSELTEDYPKENDS

SS - UNI9531 - SNNKAMTDPSRKYLTSCREKQLSLKQAEENRTSG GLLPLQSSSFYGSRAGSKDYSSGVTNLDR RCNVSSQTPSAKRSLGFLPQ

PTPLSVKKLRCNQDYAGWNRPRVPLSSHQQQLQG GFSNLGNTCYMNAILQSLFSLQSFANDLLKQSIPWKKIPFNALIR RRFANLLIKKDICNSETKK

ELLKKVKNAISATAERFSGYVQN DAHEFLSQCLDQLKEDMEKLNKTWKTEPVLGEENLPDTSATKVFTCPVITNLEFEVQHSIICKA ACGETIPKREQ

FNDLSIDLPRRKKPLPPRSIQDSLDLFFR - UNI34857 - AEELEYSCEKCGGKCALVRHKFNRLPR - UNI34857 - RVLILHLKRYSFNVAL

SLNNKLGQQVIIPRFLTLASHCTESTKPPVTLGWSAPVAI - UNI34857 - ISRPLRACQMVNSCITSPSAPSK KKFTFKSKSSVTSCLDSDSEDE

LKRSVVLSQRLCDLPGNEQYQEDVEK - UNI30467 - DLKLCRLEPGKAELENSGFDRMSEEEVLAAVLEISRREASPVLSPEDDDKPTSSPDTGFA

EDDIPEMPENPDAMEIEKSKTITEPG GPASFTEITKDCDENKENKTPEGSQGEVDWLQQYDVDREREEQELQQALAQSLQEQ EAWEQKEDDDLKRATE

LSLQE - UNI8827 - EFNNSFLDSLGSDEDSGNEDVFDMEYTEAEAEELKRNAE TGALPHSYRLISVVSHIGSTSSSG GHYISDVYDIKKQAWFT

YNDLEVSKIQEAAVQSDRDRSGYIFFYMHK KEIFDELLETEKTSQALSMEVGRAARQAS

For any suggestions or comments, please send an email to unitrap@crg.es