Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033377 (Palmd)
Chromosomal location
Chr 3: 116621181 - 116671870 (-)
Description
palmdelphin Gene [Source:MGI (curated);Acc:Palmd-001]
RefSeq_dna
NM_023245 
RefSeq_peptide
NP_075734.3 
UniGene
Mm.253736 Mm.405122 
MGI
MGI:2148896 
Uniprot/SWISSPROT
Q9JHU2 
Uniprot/SPTREMBL
Q3UVT7 Q9JHU1 
Human Ortholog
ENSG00000099260 (PALMD)
Omim not available
UniTrap UNI29133
Vector Insertion
Chr 3: 116656056 - 116671415
Public Clones IST14491B3 (tigm)
Private Clones OST7548 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000119557
Sequence
AAAGAGCTGGCAGCCCCTGAAGGAAAAGGGCTTGTGCGGCTGCCGTTCAAACTTGTCAGTCAACTCGTGCCAGCAGCCTCAGCGTCTGCCTCCCCAGTGC

ACCCTCATTACATGTGTCTGTCTGGCCTCATCTGTGCATGGGCTCTGAGCCGCTCCGCTCCTGACAGTTCGGAATTCTCTTCCTCTCTCCCTGCTGCAAA

GAGCGGATTTCTCTCCGTGTCTCTTCTGTCATCTCCAGCTCCCCTCTCCAAGGACGCACCTTGATTTATGGTAGCTTTGGACTTCCTTCAGCGTCTGCCT

GTCCTTGACTTCTAGAATGGAAGAAGCTGAGCTGGTGAAGGGAAGACTCCAGGCCATCACT - UNI29133 - GACAAAAGAAAGATACAGGAAGAAA

TCTCACAGAAGCGTCTGAAAATAGAGGAAGAAAAATTGAAACACCAACATCTGAAG AAAAAAGCCCTGAGGGAGAAATGGCTCCTGGATGGAATCGGCA

GTGGAAAAGAACACGAAGAGATGAAGAAGCAAAATCAGCAAGACCAGCACCAGACCCAGGTTCTAGAGCAAAGCATCCTCAG GCTTGAGAAAGAGATCC

AAGATCTTGAAAAGGCTGAACTGCAAATCTCAGCCAACGAAGAGGCAATTCTGAAGAAGCTAAAGTCGATCGAGAAGACCACAGAAGACATAATAAGA T

CCGTGAAGGTGGAAAAGGAAGAAAACCCAGAAG AGTCAATCGAGGACATCTATGCTAATATCCCTGACCTTCCAAGTTCCTACATACCTTCCCGATTAA

GAAAGGAAAGAAACGAAGGACCAGATGACGAACAAAACAGAAAAG CTTTGTATGCCATGGAAATTAAAGTTGAAAAAGATTTGAAGACTGGAGAGAGCG

TAGTTCTGTCTTCAATACCGCTGCCATCTGATGACTTTAAAAGCACAGGGATAAAAGTGTATGAGGACCGGCAGAAATCAGTCTATGCTGTTAGCTCCAA

TCAGAACACAACCTACAATGGCACCGACGGCCTCGCACCTGTCGAAGTGGAGGATCTCCTAAGACAAGCCTCAGAGAGGAACTCTAAATCGCCCACAGAG

TACCATGAGCCAGTGTACGCCAATCCGTTTTGCAGGCCTGTGACCCCACAGAGAGAAAGAGTCATAAGCCCTGGACCAAATTTTCAAGAAAGGATAATGA

TGAAAACGAACGGACTGGGCAACCATGCAAATGAATCTGCGCACAATATGACCGACGGGCTCTCAGAGAGGAGAAGCAACGGTCCCACTCACACCAGTCC

CACTCGGCCAACACCTCAGCCCCGATCAATGGTTCAGCAAGTGGAAGAGATGGTCCACACCCAACAAAAGAGGATGGCAAGCCCTTGGGAAGAATCCAGC

AACAGGCAAAACGAACACGAAGTTTCTCCAAGGATGGAACTGAGCCCCAGCAGAGCAAGCCCTGGGAAATCGGGACCCCAGTGTTCTTCACCCACTTGCC

AGGAGGAGACAGAAGATGTCAGATATAACATCGTTCATTCCCTGCCTTCTGATGTGGATGACACAGAACCTGTAACAATGATTTTCATGGGGTATCAGCA

GGCAGATGATAATGAGGAAGAAAAGAAGCTTTTGACAGGCTACGACGGGGTCATCCACGCTGAGCTCGTTGTGATTGATGACGAGGCGGAGGATAATGAA

GGACAAACCGAGAGGCCATCCTACCATCCCGTAGCTCCCTACAGTCAGGTTTACCAGCCACCCAAACCAACCCCACTTCCTAGAAAGAGAGCGGAAGTTA

GGCCGTATGAAAACACAAACCATAAATCTCCTCACAAAAATTCCATCTCTCTGAAAGAGCAAGAGGAACGCTTAGGCAGCCCTGCCCGGCACTCTCCCCT

GGATGTCCCAGTAGCTGGAGACGGGACTGAGGATCCTTCCTTAACAGGTAATAAAAATGACAAGGCATGCCGCTGCTGTTTACTAATGTGACAGTCTTCT

CCGTGCTAATGAACGCTCTGACTTCCGGTGTTTGTGACCACCTCATAAACTAATACACACTGGATAGCTTTTATTAACGCTGATCCGAAGTATTATCAGC

AGAGCAAAGTAAGTCGCATCAAAAAAATAATAATAATAATAACAACGAAAGTGGAAACTCCGTCTTGCTTTGTTTTAATATTGCATTGGCTGCCTCTAGC

TACTGGAGATGTATGTGTCTTCTGGGAGGGAGCAATGCCATATGTATTCACATTGGGGTTGCTAATTAATGTGCTGATCATCAGAAACATACTTTTCACA

GCAGAATCCAATGACAACTACTTTCCTGTGCCTCTCTGTGACTTAAATTTTACACGTAAGTTAACAAGTAGCCTTAATTTTAAAAGGAAATAGGAGACAC

ATACCATTTTCTTTGCATTTTATTACTCTGCTATATCTCCTTTCTCTATACTTTTATAGGTTTACTAATGTTGGTTCTTTCATTTTCTACACTTTAAAAT

TTTTATCTTGCATCATCTATGACTCAATTTTTCATAGTCTTCTCCAACTTGATGTATTTTTTTTTCTATTTTCTATACAGCCGCATTTCACATTCTCTAT

GACTTTTTATGGCTTTGTATCTCTTGAGCTATTTTATCATTGAATAATGAAAAGTAACTGCAACACCTTTTTTTCTACACACTGACAGCTCCTCGATTTC

AAATTCCTTGTTATCACTCAGATATCGAGACCTATTATCACTGATAGAAAAATGAATAAGAATCTGACAAACACAATTAGAATGACTGGGTTTACCTTAG

CTAAAAGTCTAAGTCAAATTACACAAACGCACAGGTTCTAAACATTAGAAATGCAAAGTAATTGTAAATGTTGCTAATTGAAGAATGATCATTAAAAAGC

AATAGCTATTAAGTACCAGCCATCTGAGCAAGTTGAACCTGGTAGTTTTATAGAAGTGGGTTAGGACCTCTGCAATTCAAGATCTTTCTCCCTCATCGAG

CCATAAGCCCAATCTTGTTTTGCTAATAACACCATAATAGAGACATCCTTAAATTATTTAAAGTCCTTGTTAGGTGAATCCATCACAAATTTAATCACCT

GAAGGATTTCTACCCTCCCTCATGTGTCTTCCTCAGAATCTGGAATAACGTTCCCCCACAATGGAAAGCTGCAGAGACTAAGGCCCTTTCCTTTTGGAGA

ACTGGCTTTGATGGCTGGTCAAATGCTTCTTTTGAAATTCATTCTTAAAACAATGCATGTAACATAGGGGAAGGATCGCTCTATTTATGGTCTGAAGTAT

TGGCATGACACACTAAAAACAAAC
Translation
MEEAELVKGRLQAIT - UNI29133 - DKRKIQEEISQKRLKIEEEKLKHQHLK KKALREKWLLDGIGSGKEHEEMKKQNQQDQHQTQVLEQSILR 

RLEKEIQDLEKAELQISANEEAILKKLKSIEKTTEDIIR SVKVEKEENPEE ESIEDIYANIPDLPSSYIPSRLRKERNEGPDDEQNRKA ALYAMEIK

VEKDLKTGESVVLSSIPLPSDDFKSTGIKVYEDRQKSVYAVSSNQNTTYNGTDGLAPVEVEDLLRQASERNSKSPTEYHEPVYANPFCRPVTPQRERVIS

PGPNFQERIMMKTNGLGNHANESAHNMTDGLSERRSNGPTHTSPTRPTPQPRSMVQQVEEMVHTQQKRMASPWEESSNRQNEHEVSPRMELSPSRASPGK

SGPQCSSPTCQEETEDVRYNIVHSLPSDVDDTEPVTMIFMGYQQADDNEEEKKLLTGYDGVIHAELVVIDDEAEDNEGQTERPSYHPVAPYSQVYQPPKP

TPLPRKRAEVRPYENTNHKSPHKNSISLKEQEERLGSPARHSPLDVPVAGDGTEDPSLTGNKNDKACRCCLLM
Transcript ENSMUST00000040097
Sequence
CACGGCAGCTCCCTGCGCCACTCCTGGAAAATAATGACTTGGGTAAGGAACAGTTAATAAGAAAATGTGTCTCGCTAACCGTGCACAGCACAACAAAGAG

CTGGCAGCCCCTGAAGGAAAAGGGCTTGTGCGGCTGCCGTTCAAACTTGTCAGTCAACTCGTGCCAGCAGCCTCAGCGTCTGCCTCCCCAGTGCACCCTC

ATTACATGTGTCTGTCTGGCCTCATCTGTGCATGGGCTCTGAGCCGCTCCGCTCCTGACAGTTCGGAATTCTCTTCCTCTCTCCCTGCTGCAAAGAGCGG

ATTTCTCTCCGTGTCTCTTCTGTCATCTCCAGCTCCCCTCTCCAAGGACGCACCTTGATTTATGGTAGCTTTGGACTTCCTTCAGCGTCTGCCTGTCCTT

GACTTCTAGAATGGAAGAAGCTGAGCTGGTGAAGGGAAGACTCCAGGCCATCACT - UNI29133 - GACAAAAGAAAGATACAGGAAGAAATCTCAC

AGAAGCGTCTGAAAATAGAGGAAGAAAAATTGAAACACCAACATCTGAAG AAAAAAGCCCTGAGGGAGAAATGGCTCCTGGATGGAATCGGCAGTGGAA

AAGAACACGAAGAGATGAAGAAGCAAAATCAGCAAGACCAGCACCAGACCCAGGTTCTAGAGCAAAGCATCCTCAG GCTTGAGAAAGAGATCCAAGATC

TTGAAAAGGCTGAACTGCAAATCTCAGCCAACGAAGAGGCAATTCTGAAGAAGCTAAAGTCGATCGAGAAGACCACAGAAGACATAATAAGA TCCGTGA

AGGTGGAAAAGGAAGAAAACCCAGAAG AGTCAATCGAGGACATCTATGCTAATATCCCTGACCTTCCAAGTTCCTACATACCTTCCCGATTAAGAAAGG

AAAGAAACGAAGGACCAGATGACGAACAAAACAGAAAAG CTTTGTATGCCATGGAAATTAAAGTTGAAAAAGATTTGAAGACTGGAGAGAGCGTAGTTC

TGTCTTCAATACCGCTGCCATCTGATGACTTTAAAAGCACAGGGATAAAAGTGTATGAGGACCGGCAGAAATCAGTCTATGCTGTTAGCTCCAATCAGAA

CACAACCTACAATGGCACCGACGGCCTCGCACCTGTCGAAGTGGAGGATCTCCTAAGACAAGCCTCAGAGAGGAACTCTAAATCGCCCACAGAGTACCAT

GAGCCAGTGTACGCCAATCCGTTTTGCAGGCCTGTGACCCCACAGAGAGAAAGAGTCATAAGCCCTGGACCAAATTTTCAAGAAAGGATAATGATGAAAA

CGAACGGACTGGGCAACCATGCAAATGAATCTGCGCACAATATGACCGACGGGCTCTCAGAGAGGAGAAGCAACGGTCCCACTCACACCAGTCCCACTCG

GCCAACACCTCAGCCCCGATCAATGGTTCAGCAAGTGGAAGAGATGGTCCACACCCAACAAAAGAGGATGGCAAGCCCTTGGGAAGAATCCAGCAACAGG

CAAAACGAACACGAAGTTTCTCCAAGGATGGAACTGAGCCCCAGCAGAGCAAGCCCTGGGAAATCGGGACCCCAGTGTTCTTCACCCACTTGCCAGGAGG

AGACAGAAGATGTCAGATATAACATCGTTCATTCCCTGCCTTCTGATGTGGATGACACAGAACCTGTAACAATGATTTTCATGGGGTATCAGCAGGCAGA

TGATAATGAGGAAGAAAAGAAGCTTTTGACAGGCTACGACGGGGTCATCCACGCTGAGCTCGTTGTGATTGATGACGAGGCGGAGGATAATGAAGGACAA

ACCGAGAGGCCATCCTACCATCCCGTAGCTCCCTACAGTCAGGTTTACCAGCCACCCAAACCAACCCCACTTCCTAGAAAGAGAGCGGAAGTTAGGCCGT

ATGAAAACACAAACCATAAATCTCCTCACAAAAATTCCATCTCTCTGAAAGAGCAAGAGGAACGCTTAGGCAGCCCTGCCCGGCACTCTCCCCTGGATGT

CCCAGTAGCTGGAGACGGGACTGAGGATCCTTCCTTAACAG CTTTAAGAATAAGAATGGCCAAGCTGGGGAAAAAGGTGATCTGAGAGCCGTGGTGCCC

ACCTGAATAACCTCTGAAGGAGAAGCCACGAAATGCCTGAAAACTTCTCTTCTGAATTCTTTTATTTCTTGTCCCTAAAGTCCAAAACTATATAATTATA

CCCATAGTAAGTCACATAAATAAATATTAGTCATTATTTAGGGGGGAATCCCCCCTCAAAAAAAACTGGGACAACAAATGCTAACTTTTCCAGTTACTTG

ATATGACTCAGTGGGGCCGGGGGAACCAGTATATTTTTATTGTATTGATACCAAAGCATTTCTAATAAGAGCTTGTTGAATTTAAGAATAAAGTTATTTA

AAATACCTTGACT
Translation
MEEAELVKGRLQAIT - UNI29133 - DKRKIQEEISQKRLKIEEEKLKHQHLK KKALREKWLLDGIGSGKEHEEMKKQNQQDQHQTQVLEQSILR 

RLEKEIQDLEKAELQISANEEAILKKLKSIEKTTEDIIR SVKVEKEENPEE ESIEDIYANIPDLPSSYIPSRLRKERNEGPDDEQNRKA ALYAMEIK

VEKDLKTGESVVLSSIPLPSDDFKSTGIKVYEDRQKSVYAVSSNQNTTYNGTDGLAPVEVEDLLRQASERNSKSPTEYHEPVYANPFCRPVTPQRERVIS

PGPNFQERIMMKTNGLGNHANESAHNMTDGLSERRSNGPTHTSPTRPTPQPRSMVQQVEEMVHTQQKRMASPWEESSNRQNEHEVSPRMELSPSRASPGK

SGPQCSSPTCQEETEDVRYNIVHSLPSDVDDTEPVTMIFMGYQQADDNEEEKKLLTGYDGVIHAELVVIDDEAEDNEGQTERPSYHPVAPYSQVYQPPKP

TPLPRKRAEVRPYENTNHKSPHKNSISLKEQEERLGSPARHSPLDVPVAGDGTEDPSLTA ALRIRMAKLGKKVI

For any suggestions or comments, please send an email to unitrap@crg.es