Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033411 (Ctdspl2)
Chromosomal location
Chr 2: 121781737 - 121839327 (+)
Description
CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2 Gene [Source:MGI (curated);Acc:Ctdspl2-001]
RefSeq_dna
NM_212450 
RefSeq_peptide
NP_997615.1 
UniGene
Mm.469698 
MGI
MGI:1196405 
Uniprot/SWISSPROT
Q8BG15 
Human Ortholog
ENSG00000137770 (CTDSPL2)
Omim not available
UniTrap UNI3860
Vector Insertion
Chr 2: 121782146 - 121782354
Public Clones AW0674 (sanger) CSJ286 (baygenomics) P014H11 (ggtc) D046G02 (ggtc)
F068A02 (ggtc) P081A04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15164
Vector Insertion
Chr 2: 121782494 - 121794805
Public Clones (sanger) 5SE287F11 (ggtc) D046G02 (ggtc) PST11387-NR (escells) PST11855-NR (escells)
PST23011-NR (escells) PSTVU01.H21D (vanderbilt) IST14595C2 (tigm) IST14569C7 (tigm)
IST13612G7 (tigm)
Private Clones OST279548 (lexicon) OST274430 (lexicon) OST261104 (lexicon) OST239870 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22158
Vector Insertion
Chr 2: 121794805 - 121795016
Public Clones not available
Private Clones OST305666 (lexicon) OST276436 (lexicon) OST222939 (lexicon) OST135367 (lexicon)
OST110842 (lexicon) OST54810 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18234
Vector Insertion
Chr 2: 121795016 - 121803066
Public Clones not available
Private Clones OST427111 (lexicon) OST385825 (lexicon) OST359802 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1125
Vector Insertion
Chr 2: 121795016 - 121803066
Public Clones AY0480 (sanger) AL0241 (sanger) AQ0546 (sanger) AL0220 (sanger)
AC0247 (sanger) CC0180 (sanger) AL0368 (sanger) AL0236 (sanger)
RRU391 (baygenomics) XB557 (baygenomics) RRX125 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24977
Vector Insertion
Chr 2: 121803206 - 121804627
Public Clones not available
Private Clones OST198887 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6009
Vector Insertion
Chr 2: 121804630 - 121804778
Public Clones XC715 (baygenomics) XC252 (baygenomics) CSH518 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4489
Vector Insertion
Chr 2: 121807101 - 121812684
Public Clones AT0362 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3259
Vector Insertion
Chr 2: 121814638 - 121819081
Public Clones AJ0502 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19722
Vector Insertion
Chr 2: 121819081 - 121819169
Public Clones not available
Private Clones OST382860 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32617
Vector Insertion
Chr 2: 121819493 - 121829636
Public Clones IST11797G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036647
Sequence
GCGCTCTCCTTGTCGCCCGGCTCTAGGCGGTTCCGTTAGCGGCGGGAGGGAAAACCGCCCCCGGCGTCCCCGCCTCCGCTGCTAACGCTTTCCTCCCTAC

TCCCCCTGCGACCACCCCGCAGCCCGCTACGGAGGCCCCCGAAGTACAAACGTCCCCCACGCTCCGAGCCCCATCGGAGGCTGAGTCCAGTCTAACTCCT

CGGGCCCTAAGCTCATTTTTTTTTCATTGTTTTTTGTTGTTGTTGTTTCTTGTTTTTCTTTTGGTCAGGAATTCGCTCTGGTGAGTTCCCTAAGGCGGCA

GAAACTTCAGCCTCTTCACGGTAGTAAAAGTTGGTTTCCCCTCCCCCGCTGCCGCCCAGGCCTCCCGCATTCCTTCCCTCCCGCCTCTCCGGATCGGGGC

GGGCGGGGGAGGAGGGAGCCAGAGCGCCTGCGCAGGGAGGCCGCTTTCCATCCGGGTCCCTGTCCGTGCGGTGCAGCAGGTCGGTAGGCGGGAAATGGCG

ACTGGCTGAAGGAGCTGGTTCTGTTGCTGCTGAGGGATAAGCGGGAAAGACACCACCTATTGCGCAGTCGGGACCATCGCCGGAGCCCGAAGACACTTTT

CTGTCGTCACAGTGAAG - UNI3860 - - UNI15164 - - UNI22158 - GTTTACATGTGGCACCCGTAAAAGATGAAGCTGAGAACACGGAA

GGCTTCTCAGCAGTCCAGTCCAATCCAGACACAGCGCACTGCCAGAGCAAAGAGGAAATACTCAGAGGTTGATGATAGCTTGCCTTCAGGAGGAGAAAAA

CCATCAAAGAATGAAACCGGCTTATTGTCTTCAATTAAAAAGTTCATTAAAGGAAGCACACCCAAG - UNI1125 - - UNI18234 - - UNI221

58 - GAAGAGAGAGAAAATCCTTCGAAGCGGAGTAGAATTGAACGTGATATAGATAATAATTTAATCACATCAACACCAAGAACCGGAGAAAAGCCTGA

CAAACAGTTGTCTCGAGTAAGACGGAAAAGTCCAGTCAATGGAG - UNI24977 - AAGCTGGTAGTTATGAAATGACAAATCAACATATAAAGCAAA

ATGGAAAATTAGAAGATAACCCTTGCTCTGGTAGTCCTCCGAGGACTACATTGTTGGGGACCATATTTTCGCCTGTCTTCAACTTTTTTTCACCAGCAAA

TAAAAATG - UNI6009 - GAACGTCAGGCTCAGATTCCCCAGGACAGGCTGTGGAAGCTGAGGAGATAGTGAAACAACTTGACATGGAACAGGTGGA

TGAAATTACTACCAGCACCACGTCAGCTAATGGAGCGGCTTACTCAAATCAAGCAGTTCAAGTGAGGCCATCACTAAATAATGGTTTAGAAGAAGCAGAA

GAAACAGTTACCCGGGATATCCCACCCCTTACAG - UNI4489 - CACCAGTAACTCCAGAGAGTGGGTACTCGTCAGCCCATGCAGAGGCCACCTAT

GAAGAAGACTGGGAAGTATTTGACCC CTATTATTTCATCAAACATGTTCCGCCTCTGACAGAAGAACAGCTAAATAGGAAACCTGCTCTTCCTTTGAAA

ACAAGAAGCACACCAGAGTTCTCCCTGGTCTTAGATCTG - UNI3259 - - UNI19722 - GATGAGACACTAGTGCACTGCAGTCTGAATGAGCT

AGAAGATGCAGCGCTCACTTTTCCAGTCCTTTTCCAAGATGTCATTTATCAG - UNI19722 - - UNI32617 - GTTTATGTGAGATTAAGACCA

TTCTTCAGGGAATTCCTGGAACGAATGTCTCAGATGTATGAG ATCATTCTTTTTACTGCTTCTAAGAAGGTGTATGCAGACAAGTTACTGAACATACTA

GACCCTAAAAAGCAACTGGTCAG GCACCGGCTTTTCCGTGAACATTGTGTTTGTGTACAAGGAAACTATATAAAGGACTTGAATATCCTTGGGAGAGAT

CTTTCCAAAACTATAATAATTGACAACTCACCACAAGCCTTTGCCTATCAG CTTTCTAATGGAATCCCTATAGAAAGCTGGTTTATGGATAAAAATGAC

AATGAACTCCTAAAATTGATTCCATTTCTGGAGAAGCTTGTAGAACTG AATGAAGATGTCCGGCCTCACATCAGAGACAGATTTCGATTGCATGATTTG

CTGCCCCCAGATTAAGTTCAGAGACTTGTCATATCACTGAAGGGGGGGAGAGAATGCAGGACCCTTTTGGACTAAGACAAAAACATTGCCATTACTGTTG

AAATTTTGCATTTTTGTACCCCGTCTTGCTTTCTTATCTTTGGTGCCCAATAATAATCAAGGGTTACAGAAAGAGACTCTCGGATTGAACACATACAGTG

GGTAGGCTAAAACAGAAGCGTCTGTAGAGTAGACAGCTCCAGTGAGACTCTATGTATAGGACATCTGCAGCTCATAACGAATTCTGTTTCTGCCACCAGC

AGTTTGACCTGTAGTTACACAGGATTTTATGATAATAACAGAGATGAAAGTGGACTTTCATTCTCTCTCTGTTTGGTGCTCTCAGTGGGTTTGTAGCCAC

TCTTCTGTTACTTCACTATTCTCATTTCAACAGGAATGGCCAGTAAAAGTTGTTTTATTTTTCCTGTTAAGGTTTATAACCTTTTTACATTTCTGACCTG

TATTAGATTAGAATCTCATGATGCATTCCTTTTAGTTAAGGCGCTTCATAGTTTTCTGGAAATAGTCAATTTTTAGTTTTTTTTTTAATTATACATTTGA

ATGGCCGTTTTCCTGCTTTGTCTGCCTGCATATTGTATATTTGTTTAAAAATATTCTCTACTTTTAGTCCATGTTAAGTTTCATTTAAAAGATGCATTTA

TATTTTGTTCTGTAATATTCTACTGTAGGTGAAATCTTCAAAAATCAAGAGACTGGGTAGTTAAGAATATATGAATGACTAATATTCAAATGATTTGAAT

GAACCATTGTGATGACATGTATTCCAGATGGTAATATCTTGCAATGGCACACGTTTAATGGATAAAGGTATACCTCAGACTTCACTGTGCTCACTAGCCT

TTGAGGAGAACGAGTTCAGGCACCTGTTGGGCTTGATTCGGTTACTGCTGCCTTTGGGTTTTCTCCAGGAAGGAAGTATTCAGCACAGTGACTCAGTATT

TTTACTTTGCATGGGCTGGTAGTACCTCTGTTATGCTCCCAGTTACAATCAGTTTAAAGCTCTGTGTAACAGCTGTGGTACCTAACGGTGGCTATGCATA

ATCCTGTGGCACAGTACACTCCCGGGCCACCAGTGCAGTCAATGTGCTCATAGTGGTTTTCTATGCTATATGAAAATAAGTCGTCACGCCTTGGTTCTCT

AATGCAGCTACCACAAGAGGTTGATATTTTTATAGTGGCGTGTAATCTCCTTTTCAGGAGGCTTTTTATGGAAGGTAGAATTTGTAAAAGTCAGTATGCT

TTGCCTCTCAACTGCATTAACATGCCGCAGGCTCAGACTGTTTTTGTGTAAAGGATGTCAAAGAACGGCACTTTTTCTAAAGAGAAGTTTGATATTTTGT

ATGCTTGTTAAGAAAGTACAGTATTGGAAATTAAAGGTGGACAATTGATAATTGAGGAGTATGTCAGTTAATTTTTTATGTATATTACCTGTTTACTTGT

ACAACTTATTGTACAAATTACATGCAGCTTCATTTTCAAATGAATCCTTAAAAT
Translation
 - UNI3860 - - UNI15164 - - UNI22158 - MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTP

K - UNI1125 - - UNI18234 - - UNI22158 - EERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGE - UNI24977 -

 EAGSYEMTNQHIKQNGKLEDNPCSGSPPRTTLLGTIFSPVFNFFSPANKNG - UNI6009 - GTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTS

ANGAAYSNQAVQVRPSLNNGLEEAEETVTRDIPPLTA - UNI4489 - APVTPESGYSSAHAEATYEEDWEVFDP PYYFIKHVPPLTEEQLNRKPAL

PLKTRSTPEFSLVLDL - UNI3259 - - UNI19722 - DETLVHCSLNELEDAALTFPVLFQDVIYQ - UNI19722 - - UNI32617 - VY

VRLRPFFREFLERMSQMYE IILFTASKKVYADKLLNILDPKKQLVR RHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQ LSNGIPIE

SWFMDKNDNELLKLIPFLEKLVEL NEDVRPHIRDRFRLHDLLPPD
Transcript ENSMUST00000110581
Sequence
GCGCTCTCCTTGTCGCCCGGCTCTAGGCGGTTCCGTTAGCGGCGGGAGGGAAAACCGCCCCCGGCGTCCCCGCCTCCGCTGCTAACGCTTTCCTCCCTAC

TCCCCCTGCGACCACCCCGCAGCCCGCTACGGAGGCCCCCGAAGTACAAACGTCCCCCACGCTCCGAGCCCCATCGGAGGCTGAGTCCAGTCTAACTCCT

CGGGCCCTAAGCTCATTTTTTTTTCATTGTTTTTTGTTGTTGTTGTTTCTTGTTTTTCTTTTGGTCAGGAATTCGCTCTGGTGAGTTCCCTAAGGCGGCA

GAAACTTCAGCCTCTTCACGGTAGTAAAAGTTGGTTTCCCCTCCCCCGCTGCCGCCCAGGCCTCCCGCATTCCTTCCCTCCCGCCTCTCCGGATCGGGGC

GGGCGGGGGAGGAGGGAGCCAGAGCGCCTGCGCAGGGAGGCCGCTTTCCATCCGGGTCCCTGTCCGTGCGGTGCAGCAGGTCGGTAGGCGGGAAATGGCG

ACTGGCTGAAGGAGCTGGTTCTGTTGCTGCTGAGGGATAAGCGGGAAAGACACCACCTATTGCGCAGTCGGGACCATCGCCGGAGCCCGAAGACACTTTT

CTGTCGTCACAGTGAAG - UNI3860 - - UNI15164 - - UNI22158 - GTTTACATGTGGCACCCGTAAAAGATGAAGCTGAGAACACGGAA

GGCTTCTCAGCAGTCCAGTCCAATCCAGACACAGCGCACTGCCAGAGCAAAGAGGAAATACTCAGAGGTTGATGATAGCTTGCCTTCAGGAGGAGAAAAA

CCATCAAAGAATGAAACCGGCTTATTGTCTTCAATTAAAAAGTTCATTAAAGGAAGCACACCCAAG - UNI1125 - - UNI18234 - - UNI221

58 - GAAGAGAGAGAAAATCCTTCGAAGCGGAGTAGAATTGAACGTGATATAGATAATAATTTAATCACATCAACACCAAGAACCGGAGAAAAGCCTGA

CAAACAGTTGTCTCGAGTAAGACGGAAAAGTCCAGTCAATGGAG - UNI24977 - AAGCTGGTAGTTATGAAATGACAAATCAACATATAAAGCAAA

ATGGAAAATTAGAAGATAACCCTTGCTCTGGTAGTCCTCCGAGGACTACATTGTTGGGGACCATATTTTCGCCTGTCTTCAACTTTTTTTCACCAGCAAA

TAAAAATG - UNI4489 - - UNI6009 - CACCAGTAACTCCAGAGAGTGGGTACTCGTCAGCCCATGCAGAGGCCACCTATGAAGAAGACTGGGA

AGTATTTGACCC CTATTATTTCATCAAACATGTTCCGCCTCTGACAGAAGAACAGCTAAATAGGAAACCTGCTCTTCCTTTGAAAACAAGAAGCACACC

AGAGTTCTCCCTGGTCTTAGATCTG - UNI3259 - - UNI19722 - GATGAGACACTAGTGCACTGCAGTCTGAATGAGCTAGAAGATGCAGCGC

TCACTTTTCCAGTCCTTTTCCAAGATGTCATTTATCAG - UNI19722 - - UNI32617 - GTTTATGTGAGATTAAGACCATTCTTCAGGGAATT

CCTGGAACGAATGTCTCAGATGTATGAG ATCATTCTTTTTACTGCTTCTAAGAAGGTGTATGCAGACAAGTTACTGAACATACTAGACCCTAAAAAGCA

ACTGGTCAG GCACCGGCTTTTCCGTGAACATTGTGTTTGTGTACAAGGAAACTATATAAAGGACTTGAATATCCTTGGGAGAGATCTTTCCAAAACTAT

AATAATTGACAACTCACCACAAGCCTTTGCCTATCAG CTTTCTAATGGAATCCCTATAGAAAGCTGGTTTATGGATAAAAATGACAATGAACTCCTAAA

ATTGATTCCATTTCTGGAGAAGCTTGTAGAACTG AATGAAGATGTCCGGCCTCACATCAGAGACAGATTTCGATTGCATGATTTGCTGCCCCCAGATTA

AGTTCAGAGACTTGTCATATCACTGAAGGGGGGGAGAGAATGCAGGACCCTTTTGGACTAAGACAAAAACATTGCCATTACTGTTGAAATTTTGCATTTT

TGTACCCCGTCTTGCTTTCTTATCTTTGGTGCCCAATAATAATCAAGGGTTACAGAAAGAGACTCTCGGATTGAACACATACAGTGGGTAGGCTAAAACA

GAAGCGTCTGTAGAGTAGACAGCTCCAGTGAGACTCTATGTATAGGACATCTGCAGCTCATAACGAATTCTGTTTCTGCCACCAGCAGTTTGACCTGTAG

TTACACAGGATTTTATGATAATAACAGAGATGAAAGTGGACTTTCATTCTCTCTCTGTTTGGTGCTCTCAGTGGGTTTGTAGCCACTCTTCTGTTACTTC

ACTATTCTCATTTCAACAGGAATGGCCAGTAAAAGTTGTTTTATTTTTCCTGTTAAGGTTTATAACCTTTTTACATTTCTGACCTGTATTAGATTAGAAT

CTCATGATGCATTCCTTTTAGTTAAGGCGCTTCATAGTTTTCTGGAAATAGTCAATTTTTAGTTTTTTTTTTAATTATACATTTGAATGGCCGTTTTCCT

GCTTTGTCTGCCTGCATATTGTATATTTGTTTAAAAATATTCTCTACTTTTAGTCCATGTTAAGTTTCATTTAAAAGATGCATTTATATTTTGTTCTGTA

ATATTCTACTGTAGGTGAAATCTTCAAAAATCAAGAGACTGGGTAGTTAAGAATATATGAATGACTAATATTCAAATGATTTGAATGAACCATTGTGATG

ACATGTATTCCAGATGGTAATATCTTGCAATGGCACACGTTTAATGGATAAAGGTATACCTCAGACTTCACTGTGCTCACTAGCCTTTGAGGAGAACGAG

TTCAGGCACCTGTTGGGCTTGATTCGGTTACTGCTGCCTTTGGGTTTTCTCCAGGAAGGAAGTATTCAGCACAGTGACTCAGTATTTTTACTTTGCATGG

GCTGGTAGTACCTCTGTTATGCTCCCAGTTACAATCAGTTTAAAGCTCTGTGTAACAGCTGTGGTACCTAACGGTGGCTATGCATAATCCTGTGGCACAG

TACACTCCCGGGCCACCAGTGCAGTCAATGTGCTCATAGTGGTTTTCTATGCTATATGAAAATAAGTCGTCACGCCTTGGTTCTCTAATGCAGCTACCAC

AAGAGGTTGATATTTTTATAGTGGCGTGTAATCTCCTTTTCAGGAGGCTTTTTATGGAAGGTAGAATTTGTAAAAGTCAGTATGCTTTGCCTCTCAACTG

CATTAACATGCCGCAGGCTCAGACTGTTTTTGTGTAAAGGATGTCAAAGAACGGCACTTTTTCTAAAGAGAAGTTTGATATTTTGTATGCTTGTTAAGAA

AGTACAGTATTGGAAATTAAAGGTGGACAATTGATAATTGAGGAGTATGTCAGTTAATTTTTTATGTATATTACCTGTTTACTTGTACAACTTATTGTAC

AAATTACATGCAGCTTCATTTTCAAATGAATCCTTAAAAT
Translation
 - UNI3860 - - UNI15164 - - UNI22158 - MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTP

K - UNI1125 - - UNI18234 - - UNI22158 - EERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGE - UNI24977 -

 EAGSYEMTNQHIKQNGKLEDNPCSGSPPRTTLLGTIFSPVFNFFSPANKNA - UNI4489 - - UNI6009 - APVTPESGYSSAHAEATYEEDWE

VFDP PYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDL - UNI3259 - - UNI19722 - DETLVHCSLNELEDAALTFPVLFQDVIYQ -

 UNI19722 - - UNI32617 - VYVRLRPFFREFLERMSQMYE IILFTASKKVYADKLLNILDPKKQLVR RHRLFREHCVCVQGNYIKDLNILGR

DLSKTIIIDNSPQAFAYQ LSNGIPIESWFMDKNDNELLKLIPFLEKLVEL NEDVRPHIRDRFRLHDLLPPD
Transcript ENSMUST00000110578
Sequence
GGAGGGAGCCAGAGCGCCTGCGCAGGGAGGCCGCTTTCCATCCGGGTCCCTGTCCGTGCGGTGCAGCAGGTCGGTAGGCGGGAAATGGCGACTGGCTGAA

GGAGCTGGTTCTGTTGCTGCTGAGGGATAAGCGGGAAAGACACCACCTATTGCGCAGTCGGGACCATCGCCGGAGCCCGAAGACACTTTTCTGTCGTCAC

AGTGAAG - UNI3860 - - UNI15164 - - UNI22158 - GTTTACATGTGGCACCCGTAAAAGATGAAGCTGAGAACACGGAAGGCTTCTCAG

CAGTCCAGTCCAATCCAGACACAGCGCACTGCCAGAGCAAAGAGGAAATACTCAGAGGTTGATGATAGCTTGCCTTCAGGAGGAGAAAAACCATCAAAGA

ATGAAACCGGCTTATTGTCTTCAATTAAAAAGTTCATTAAAGGAAGCACACCCAAG - UNI1125 - - UNI18234 - - UNI22158 - GAAGA

GAGAGAAAATCCTTCGAAGCGGAGTAGAATTGAACGTGATATAGATAATAATTTAATCACATCAACACCAAGAACCGGAGAAAAGCCTGACAAACAGTTG

TCTCGAGTAAGACGGAAAAGTCCAGTCAATGGAG - UNI6009 - - UNI24977 - CTGGTAGTTATGAAATGACAAATCAACATATAAAGCAAAA

TGGAAAATTAGAAGATAACCCTTGCTCTGGTAGTCCTCCGAGGACTACATTGTTGGGGACCATATTTTCGCCTGTCTTCAACTTTTTTTCACCAGCAAAT

AAAAATG - UNI6009 - GAACGTCAGGCTCAGATTCCCCAGGACAGGCTGTGGAAGCTGAGGAGATAGTGAAACAACTTGACATGGAACAGGTGGAT

GAAATTACTACCAGCACCACGTCAGCTAATGGAGCGGCTTACTCAAATCAAGCAGTTCAAGTGAGGCCATCACTAAATAATGGTTTAGAAGAAGCAGAAG

AAACAGTTACCCGGGATATCCCACCCCTTACAG - UNI4489 - CACCAGTAACTCCAGAGAGTGGGTACTCGTCAGCCCATGCAGAGGCCACCTATG

AAGAAGACTGGGAAGTATTTGACCC CTATTATTTCATCAAACATGTTCCGCCTCTGACAGAAGAACAGCTAAATAGGAAACCTGCTCTTCCTTTGAAAA

CAAGAAGCACACCAGAGTTCTCCCTGGTCTTAGATCTG - UNI3259 - - UNI19722 - GATGAGACACTAGTGCACTGCAGTCTGAATGAGCTA

GAAGATGCAGCGCTCACTTTTCCAGTCCTTTTCCAAGATGTCATTTATCAG - UNI19722 - - UNI32617 - GTTTATGTGAGATTAAGACCAT

TCTTCAGGGAATTCCTGGAACGAATGTCTCAGATGTATGAG ATCATTCTTTTTACTGCTTCTAAGAAGGTGTATGCAGACAAGTTACTGAACATACTAG

ACCCTAAAAAGCAACTGGTCAG GCACCGGCTTTTCCGTGAACATTGTGTTTGTGTACAAGGAAACTATATAAAGGACTTGAATATCCTTGGGAGAGATC

TTTCCAAAACTATAATAATTGACAACTCACCACAAGCCTTTGCCTATCAG CTTTCTAATGGAATCCCTATAGAAAGCTGGTTTATGGATAAAAATGACA

ATGAACTCCTAAAATTGATTCCATTTCTGGAGAAGCTTGTAGAACTG AATGAAGATGTCCGGCCTCACATCAGAGACAGATTTCGATTGCATGATTTGC

TGCCCCCAGATTAAGTTCAGAGACTTGTCATATCACTGAAGGGGGGGAGAGAATGCAGGACCCTTTTGGACTAAGACAAAAACATTGCCATTACTGTTGA

AATTTTGCATTTTTGTACCCCGTCTTGCTTTCTTATCTTTGGTGCCCAATAATAATCAAGGGTTACAGAAAGAGACTCTCGGATTGAACACATACAGTGG

GTAGGCTAAAACAGAAGCGTCTGTAGAGTAGACAGCTCCAGTGAGACTCTATGTATAGGACATCTGCAGCTCATAACGAATTCTGTTTCTGCCACCAGCA

GTTTGACCTGTAGTTACACAGGATTTTATGATAATAACAGAGATGAAAGTGGACTTTCATTCTCTCTCTGTTTGGTGCTCTCAGTGGGTTTGTAGCCACT

CTTCTGTTACTTCACTATTCTCATTTCAACAGGAATGGCCAGTAAAAGTTGTTTTATTTTTCCTGTTAAGGTTTATAACCTTTTTACATTTCTGACCTGT

ATTAGATTAGAATCTCATGATGCATTCCTTTTAGTTAAGGCGCTTCATAGTTTTCTGGAAATAGTCAATTTTTAGTTTTTTTTTTAATTATACATTTGAA

TGGCCGTTTTCCTGCTTTGTCTGCCTGCATATTGTATATTTGTTTAAAAATATTCTCTACTTTTAGTCCATGTTAAGTTTCATTTAAAAGATGCATTTAT

ATTTTGTTCTGTAATATTCTACTGTAGGTGAAATCTTCAAAAATCAAGAGACTGGGTAGTTAAGAATATATGAATGACTAATATTCAAATGATTTGAATG

AACCATTGTGATGACATGTATTCCAGATGGTAATATCTTGCAATGGCACACGTTTAATGGATAAAGGTATACCTCAGACTTCACTGTGCTCACTAGCCTT

TGAGGAGAACGAGTTCAGGCACCTGTTGGGCTTGATTCGGTTACTGCTGCCTTTGGGTTTTCTCCAGGAAGGAAGTATTCAGCACAGTGACTCAGTATTT

TTACTTTGCATGGGCTGGTAGTACCTCTGTTATGCTCCCAGTTACAATCAGTTTAAAGCTCTGTGTAACAGCTGTGGTACCTAACGGTGGCTATGCATAA

TCCTGTGGCACAGTACACTCCCGGGCCACCAGTGCAGTCAATGTGCTCATAGTGGTTTTCTATGCTATATGAAAATAAGTCGTCACGCCTTGGTTCTCTA

ATGCAGCTACCACAAGAGGTTGATATTTTTATAGTGGCGTGTAATCTCCTTTTCAGGAGGCTTTTTATGGAAGGTAGAATTTGTAAAAGTCAGTATGCTT

TGCCTCTCAACTGCATTAACATGCCGCAGGCTCAGACTGTTTTTGTGTAAAGGATGTCAAAGAACGGCACTTTTTCTAAAGAGAAGTTTGATATTTTGTA

TGCTTGTTAAGAAAGTACAGTATTGGAAATTAAAGGTGGACAATTGATAATTGAGGAGTATGTCAGTTAATTTTTTATGTATATTACCTGTTTACTTGTA

CAACTTATTGTACAAATTACATGCAGCTTCATTTTCAAATGAATCCTTAAAATAAGGAAATCTTTTTAGGAAAACATTTAATTTTTGTATTTTTGATTTT

AAAGGCATGAGTTGTCAGTTTTCAGTGTATTAATGAAGATTTTAACTTTTCATCAGGTTGAGTGTTTTCTTACTATATTATCTGTTGTGTATGTAGTTAG

CATATTGTGTCACTGAACTGTTTAAAAATCTAGCATGTAGAGCAAGCCTGTTTTGTGGAAAATCCTTATTCATT
Translation
 - UNI3860 - - UNI15164 - - UNI22158 - MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTP

K - UNI1125 - - UNI18234 - - UNI22158 - EERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGA - UNI6009 - 

- UNI24977 - AGSYEMTNQHIKQNGKLEDNPCSGSPPRTTLLGTIFSPVFNFFSPANKNG - UNI6009 - GTSGSDSPGQAVEAEEIVKQLDME

QVDEITTSTTSANGAAYSNQAVQVRPSLNNGLEEAEETVTRDIPPLTA - UNI4489 - APVTPESGYSSAHAEATYEEDWEVFDP PYYFIKHVPPL

TEEQLNRKPALPLKTRSTPEFSLVLDL - UNI3259 - - UNI19722 - DETLVHCSLNELEDAALTFPVLFQDVIYQ - UNI19722 - - UN

I32617 - VYVRLRPFFREFLERMSQMYE IILFTASKKVYADKLLNILDPKKQLVR RHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFA

YQ LSNGIPIESWFMDKNDNELLKLIPFLEKLVEL NEDVRPHIRDRFRLHDLLPPD
Transcript ENSMUST00000110574
Sequence
AGTCCTCTCTCAGGGCCGTCTGCCGGGATCTCCTCCCCTTCTCTAGCCGAGCCCTCAGCGGTTCCAGCAACGTCCGTAGGCATGCACTGTTGGCGCCTT 

- UNI15164 - - UNI22158 - GTTTACATGTGGCACCCGTAAAAGATGAAGCTGAGAACACGGAAGGCTTCTCAGCAGTCCAGTCCAATCCAGAC

ACAGCGCACTGCCAGAGCAAAGAGGAAATACTCAGAGGTTGATGATAGCTTGCCTTCAGGAGGAGAAAAACCATCAAAGAATGAAACCGGCTTATTGTCT

TCAATTAAAAAGTTCATTAAAGGAAGCACACCCAAG - UNI1125 - - UNI18234 - - UNI22158 - GAAGAGAGAGAAAATCCTTCGAAGC

GGAGTAGAATTGAACGTGATATAGATAATAATTTAATCACATCAACACCAAGAACCGGAGAAAAGCCTGACAAACAGTTGTCTCGAGTAAGACGGAAAAG

TCCAGTCAATGGAG - UNI24977 - AAGCTGGTAGTTATGAAATGACAAATCAACATATAAAGCAAAATGGAAAATTAGAAGATAACCCTTGCTCTG

GTAGTCCTCCGAGGACTACATTGTTGGGGACCATATTTTCGCCTGTCTTCAACTTTTTTTCACCAGCAAATAAAAATG - UNI6009 - GAACGTCAG

GCTCAGATTCCCCAGGACAGGCTGTGGAAGCTGAGGAGATAGTGAAACAACTTGACATGGAACAGGTGGATGAAATTACTACCAGCACCACGTCAGCTAA

TGGAGCGGCTTACTCAAATCAAGCAGTTCAAGTGAGGCCATCACTAAATAATGGTTTAGAAGAAGCAGAAGAAACAGTTACCCGGGATATCCCACCCCTT

ACAG - UNI4489 - CACCAGTAACTCCAGAGAGTGGGTACTCGTCAGCCCATGCAGAGGCCACCTATGAAGAAGACTGGGAAGTATTTGACCC CTA

TTATTTCATCAAACATGTTCCGCCTCTGACAGAAGAACAGCTAAATAGGAAACCTGCTCTTCCTTTGAAAACAAGAAGCACACCAGAGTTCTCCCTGGTC

TTAGATCTG - UNI3259 - - UNI19722 - GATGAGACACTAGTGCACTGCAGTCTGAATGAGCTAGAAGATGCAGCGCTCACTTTTCCAGTCCT

TTTCCAAGATGTCATTTATCAG - UNI19722 - - UNI32617 - GTTTATGTGAGATTAAGACCATTCTTCAGGGAATTCCTGGAACGAATGTCT

CAGATGTATGAG ATCATTCTTTTTACTGCTTCTAAGAAGGTGTATGCAGACAAGTTACTGAACATACTAGACCCTAAAAAGCAACTGGTCAG GCACCG

GCTTTTCCGTGAACATTGTGTTTGTGTACAAGGAAACTATATAAAGGACTTGAATATCCTTGGGAGAGATCTTTCCAAAACTATAATAATTGACAACTCA

CCACAAGCCTTTGCCTATCAG CTTTCTAATGGAATCCCTATAGAAAGCTGGTTTATGGATAAAAATGACAATGAACTCCTAAAATTGATTCCATTTCTG

GAGAAGCTTGTAGAACTG AATGAAGATGTCCGGCCTCACATCAGAGACAGATTTCGATTGCATGATTTGCTGCCCCCAGATTAAGTTCAGAGACTTGTC

ATATCACTGAAGGGGGGGAGAGAATGCAGGACCCTTTTGGACTAAGACAAAAACATTGCCATTACTGTTGAAATTTTGCA
Translation
 - UNI15164 - - UNI22158 - MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPK - UNI1125 

- - UNI18234 - - UNI22158 - EERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGE - UNI24977 - EAGSYEMTNQH

IKQNGKLEDNPCSGSPPRTTLLGTIFSPVFNFFSPANKNG - UNI6009 - GTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTSANGAAYSNQAVQ

VRPSLNNGLEEAEETVTRDIPPLTA - UNI4489 - APVTPESGYSSAHAEATYEEDWEVFDP PYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSL

VLDL - UNI3259 - - UNI19722 - DETLVHCSLNELEDAALTFPVLFQDVIYQ - UNI19722 - - UNI32617 - VYVRLRPFFREFLE

RMSQMYE IILFTASKKVYADKLLNILDPKKQLVR RHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQ LSNGIPIESWFMDKNDNELL

KLIPFLEKLVEL NEDVRPHIRDRFRLHDLLPPD
Transcript ENSMUST00000110572
Sequence
CACCCGTAAAAGATGAAGCTGAGAACACGGAAGGCTTCTCAGCAGTCCAGTCCAATCCAGACACAGCGCACTGCCAGAGCAAAGAGGAAATACTCAGAGG

TTGATGATAGCTTGCCTTCAGGAGGAGAAAAACCATCAAAGAATGAAACCGGCTTATTGTCTTCAATTAAAAAGTTCATTAAAGGAAGCACACCCAAG -

 UNI1125 - - UNI18234 - - UNI22158 - GAAGAGAGAGAAAATCCTTCGAAGCGGAGTAGAATTGAACGTGATATAGATAATAATTTAATC

ACATCAACACCAAGAACCGGAGAAAAGCCTGACAAACAGTTGTCTCGAGTAAGACGGAAAAGTCCAGTCAATGGAG - UNI24977 - AAGCTGGTAG

TTATGAAATGACAAATCAACATATAAAGCAAAATGGAAAATTAGAAGATAACCCTTGCTCTGGTAGTCCTCCGAGGACTACATTGTTGGGGACCATATTT

TCGCCTGTCTTCAACTTTTTTTCACCAGCAAATAAAAATG - UNI4489 - - UNI6009 - CACCAGTAACTCCAGAGAGTGGGTACTCGTCAGCC

CATGCAGAGGCCACCTATGAAGAAGACTGGGAAGTATTTGACCC CTATTATTTCATCAAACATGTTCCGCCTCTGACAGAAGAACAGCTAAATAGGAAA

CCTGCTCTTCCTTTGAAAACAAGAAGCACACCAGAGTTCTCCCTGGTCTTAGATCTG - UNI3259 - - UNI19722 - GATGAGACACTAGTGCA

CTGCAGTCTGAATGAGCTAGAAGATGCAGCGCTCACTTTTCCAGTCCTTTTCCAAGATGTCATTTATCAG - UNI19722 - - UNI32617 - GTT

TATGTGAGATTAAGACCATTCTTCAGGGAATTCCTGGAACGAATGTCTCAGATGTATGAG ATCATTCTTTTTACTGCTTCTAAGAAGGTGTATGCAGAC

AAGTTACTGAACATACTAGACCCTAAAAAGCAACTGGTCAG GCACCGGCTTTTCCGTGAACATTGTGTTTGTGTACAAGGAAACTATATAAAGGACTTG

AATATCCTTGGGAGAGATCTTTCCAAAACTATAATAATTGACAACTCACCACAAGCCTTTGCCTATCAG CTTTCTAATGGAATCCCTATAGAAAGCTGG

TTTATGGATAAAAATGACAATGAACTCCTAAAATTGATTCCATTTCTGGAGAAGCTTGTAGAACTG AATGAAGATGTCCGGCCTCACATCAGAGACAGA

TTTCGATTGCATGATTTGCTGCCCCCAGATTAAGTTCAGAGACTTGTCATATCACTGAAGGGGGGGAGAGAATGCAGGACCCTTTTGGACTAAGACAAAA

ACATTGCCATTACTGTTGAAATTTTGCATTTTTGTACCCCGTCTTGCTTTCTTATCTTTGGTGCCCAATAATAATCAAGGGTTACAGAAAGAGACTCTCG

GATTGAACACATACAGTGGGTAGGCTAAAACAGAAGCGTCTGTAGAGTAGACAGCTCCAGTGAGACTCTATGTATAGGACATCTGCAGCTCATAACGAAT

TCTGTTTCTGCCACCAGCAGTTTGACCTGTAGTTACACAGGATTTTATGATAATAACAGAGATGAAAGTGGACTTTCATTCTCTCTCTGTTTGGTGCTCT

CAGTGGGTTTGTAGCCACTCTTCTGTTACTTCACTATTCTCATTTCAACAGGAATGGCCAGTAAAAGTTGTTTTATTTTTCCTGTTAAGGTTTATAACCT

TTTTACATTTCTGACCTGTATTAGATTAGAATCTCATGATGCATTCCTTTTAGTTAAGGCGCTTCATAGTTTTCTGGAAATAGTCAATTTTTAGTTTTTT

TTTTAATTATACATTTGAATGGCCGTTTTCCTGCTTTGTCTGCCTGCATATTGTATATTTGTTTAAAAATATTCTCTACTTTTAGTCCATGTTAAGTTTC

ATTTAAAAGATGCATTTATATTTTGTTCTGTAATATTCTACTGTAGGTGAAATCTTCAAAAATCAAGAGACTGGGTAGTTAAGAATATATGAATGACTAA

TATTCAAATGATTTGAATGAACCATTGTGATGACATGTATTCCAGATGGTAATATCTTGCAATGGCACACGTTTAATGGATAAAGGTATACCTCAGACTT

CACTGTGCTCACTAGCCTTTGAGGAGAACGAGTTCAGGCACCTGTTGGGCTTGATTCGGTTACTGCTGCCTTTGGGTTTTCTCCAGGAAGGAAGTATTCA

GCACAGTGACTCAGTATTTTTACTTTGCATGGGCTGGTAGTACCTCTGTTATGCTCCCAGTTACAATCAGTTTAAAGCTCTGTGTAACAGCTGTGGTACC

TAACGGTGGCTATGCATAATCCTGTGGCACAGTACACTCCCGGGCCACCAGTGCAGTCAATGTGCTCATAGTGGTTTTCTATGCTATATGAAAATAAGTC

GTCACGCCTTGGTTCTCTAATGCAGCTACCACAAGAGGTTGATATTTTTATAGTGGCGTGTAATCTCCTTTTCAGGAGGCTTTTTATGGAAGGTAGAATT

TGTAAAAGTCAGTATGCTTTGCCTCTCAACTGCATTAACATGCCGCAGGCTCAGACTGTTTTTGTGTAAAGGATGTCAAAGAACGGCACTTTTTCTAAAG

AGAAGTTTGATATTTTGTATGCTTGTTAAGAAAGTACAGTATTGGAAATTAAAGGTGGACAATTGATAATTGAGGAGTATGTCAGTTAATTTTTTATGTA

TATTACCTGTTTACTTGTACAACTTATTGTACAAATTACATGCAGCTTCATTTTCAAATGAATCCTTAAAATAAGGAAATCTTTTTAGGAAAACATTTAA

TTTTTGTATTTTTGATTTTAAAGGCATGAGTTGTCAGTTTTCAGTGTATTAATGAAGATTTTAACTTTTCATCAGGTTGAGTGTTTTCTTACTATATTAT

CTGTTGTGTATGTAGTTAGCATATTGTGTCACTGAACTGTTTAAAAATCTAGCATGTAGAGCAAGCCTGTTTTGTGGAAAATCCTTATTCATTAAAAAAA

ATAATCATGGCAGATTTTCTGCAAAAAAAAAAAAAGCAAAAGCATTTGCAATTCAGATTTTTTTTATTTAAAAAAAAAAGGTATTTTGCTTGCAGGAACA

ATACTACAGATTCATTTTAATGAGAATCTTCGAAATGTATTTATCTTTAGGGCACCTGGGCATCTTTATGCTGTTTGTCTTATGTCTTTCTTGAAATAAA

ATGTAAATATGTTACCTTTACATATGCTCTTTCTCAAAATTGTGAACCTAGTTAATATCTTCTTGCCCCCATCATTTTTATGCTTATACAGCAAACCCCA

AAACCTGTACAAGATTGAATTTTTGACAAACATAATTGTTGACAATGTACTTGATCAGGAATTAAGTAAATACAGTCTCAAAGCCCTTCCCACATCTTAA

AAGGGGAAACACTTATACCATAGTGCCTGTGGGCACTTTAATAATAAAAAAGCAGGCCTGTGCCAGGGGAATGAGCTCCTACTCAGCCAGTAGGTGAGTC

AACAATACACTTTTGTAGAGAAATGTAACGTGGGAAAGTTTACATGGCCTGAGAGTTGAGACCAAATTAATAGATTATTTTTTTCTATTACTTTGAGTAA

TTCTAAAGTTGTTGATAACAAAGTTTAAAGAAGATTATAAAGAAGTTTGCTGGCTTCTTTTCATTTTAATAGGTTTATCTTTCAATCATATCTTTTCTTT

GTTGGTAACTGTAGAACGCTTCCTTTTAGTTAATCAGAGGTGTGTACTTTTTTAATTGCAATGTGCCCAGCCTGTCAGTGCACACAGCACACATGACTAT

AGTAAATGCAGGGGCCATGGGTCCATGAAGCACACAGCAAGCTACCTGTGTACACATTACAACTCTTAAGGACCTATTAAAATTGTGCTATTTCCAGTTA

TGAATGTTTGACTTTTAAGACATTCTTTTAAATATTTGTATCATTGTTAGAGAATATTTGCTTGGTTGTATTTTTTAGACCCATGTAATATATGTAGTCC

TGACCAGATTTATTACCATTTTTCTCTGGGTCCTAAAAGAGATCGATGACAATTCGTAACCAGAAATTGTTTTATATTTGCTAGTATGTATATTTATTTA

TCCAATGGCTTTATTTGTTTCCCAAAATTGTTTTGGGACTTGTTGAAAGCATTGTGTAACTTCTATAAATGGCTATTTTCTTGTAACTGTCAGTGA
Translation
MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTPK - UNI1125 - - UNI18234 - - UNI22158 -

 EERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGE - UNI24977 - EAGSYEMTNQHIKQNGKLEDNPCSGSPPRTTLLGTIFS

PVFNFFSPANKNA - UNI4489 - - UNI6009 - APVTPESGYSSAHAEATYEEDWEVFDP PYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSL

VLDL - UNI3259 - - UNI19722 - DETLVHCSLNELEDAALTFPVLFQDVIYQ - UNI19722 - - UNI32617 - VYVRLRPFFREFLE

RMSQMYE IILFTASKKVYADKLLNILDPKKQLVR RHRLFREHCVCVQGNYIKDLNILGRDLSKTIIIDNSPQAFAYQ LSNGIPIESWFMDKNDNELL

KLIPFLEKLVEL NEDVRPHIRDRFRLHDLLPPD
Transcript ENSMUST00000099470
Sequence
GCGCTCTCCTTGTCGCCCGGCTCTAGGCGGTTCCGTTAGCGGCGGGAGGGAAAACCGCCCCCGGCGTCCCCGCCTCCGCTGCTAACGCTTTCCTCCCTAC

TCCCCCTGCGACCACCCCGCAGCCCGCTACGGAGGCCCCCGAAGTACAAACGTCCCCCACGCTCCGAGCCCCATCGGAGGCTGAGTCCAGTCTAACTCCT

CGGGCCCTAAGCTCATTTTTTTTTCATTGTTTTTTGTTGTTGTTGTTTCTTGTTTTTCTTTTGGTCAGGAATTCGCTCTGGTGAGTTCCCTAAGGCGGCA

GAAACTTCAGCCTCTTCACGGTAGTAAAAGTTGGTTTCCCCTCCCCCGCTGCCGCCCAGGCCTCCCGCATTCCTTCCCTCCCGCCTCTCCGGATCGGGGC

GGGCGGGGGAGGAGGGAGCCAGAGCGCCTGCGCAGGGAGGCCGCTTTCCATCCGGGTCCCTGTCCGTGCGGTGCAGCAGGTCGGTAGGCGGGAAATGGCG

ACTGGCTGAAGGAGCTGGTTCTGTTGCTGCTGAGGGATAAGCGGGAAAGACACCACCTATTGCGCAGTCGGGACCATCGCCGGAGCCCGAAGACACTTTT

CTGTCGTCACAGTGAAG - UNI3860 - - UNI15164 - - UNI22158 - GTTTACATGTGGCACCCGTAAAAGATGAAGCTGAGAACACGGAA

GGCTTCTCAGCAGTCCAGTCCAATCCAGACACAGCGCACTGCCAGAGCAAAGAGGAAATACTCAGAGGTTGATGATAGCTTGCCTTCAGGAGGAGAAAAA

CCATCAAAGAATGAAACCGGCTTATTGTCTTCAATTAAAAAGTTCATTAAAGGAAGCACACCCAAG - UNI1125 - - UNI18234 - - UNI221

58 - GAAGAGAGAGAAAATCCTTCGAAGCGGAGTAGAATTGAACGTGATATAGATAATAATTTAATCACATCAACACCAAGAACCGGAGAAAAGCCTGA

CAAACAGTTGTCTCGAGTAAGACGGAAAAGTCCAGTCAATGGAG - UNI24977 - AAGCTGGTAGTTATGAAATGACAAATCAACATATAAAGCAAA

ATGGAAAATTAGAAGATAACCCTTGCTCTGGTAGTCCTCCGAGGACTACATTGTTGGGGACCATATTTTCGCCTGTCTTCAACTTTTTTTCACCAGCAAA

TAAAAATG - UNI6009 - GAACGTCAGGCTCAGATTCCCCAGGACAGGCTGTGGAAGCTGAGGAGATAGTGAAACAACTTGACATGGAACAGGTGGA

TGAAATTACTACCAGCACCACGTCAGCTAATGGAGCGGCTTACTCAAATCAAGCAGTTCAAGTGAGGCCATCACTAAATAATGGTTTAGAAGAAGCAGAA

GAAACAGTTACCCGGGATATCCCACCCCTTACAG - UNI4489 - CACCAGTAACTCCAGAGAGTGGGTACTCGTCAGCCCATGCAGAGGCCACCTAT

GAAGAAGACTGGGAAGTATTTGACCC CTATTATTTCATCAAACATGTTCCGCCTCTGACAGAAGAACAGCTAAATAGGAAACCTGCTCTTCCTTTGAAA

ACAAGAAGCACACCAGAGTTCTCCCTGGTCTTAGATCTG - UNI3259 - - UNI19722 - GATGAGACACTAGTGCACTGCAGTCTGAATGAGCT

AGAAGATGCAGCGCTCACTTTTCCAGTCCTTTTCCAAGATGTCATTTATCAG - UNI19722 - CAGGTGGAGGCAAGGAACACTGATACAGATCCCC

AAGAACAACTTGCCACGTTAAGACTGGGATTTTGTCTTTATTTTTCCCCATAA
Translation
 - UNI3860 - - UNI15164 - - UNI22158 - MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTP

K - UNI1125 - - UNI18234 - - UNI22158 - EERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGE - UNI24977 -

 EAGSYEMTNQHIKQNGKLEDNPCSGSPPRTTLLGTIFSPVFNFFSPANKNG - UNI6009 - GTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTS

ANGAAYSNQAVQVRPSLNNGLEEAEETVTRDIPPLTA - UNI4489 - APVTPESGYSSAHAEATYEEDWEVFDP PYYFIKHVPPLTEEQLNRKPAL

PLKTRSTPEFSLVLDL - UNI3259 - - UNI19722 - DETLVHCSLNELEDAALTFPVLFQDVIYQ - UNI19722 - QVEARNTDTDPQEQL

ATLRLGFCLYFSP
Transcript ENSMUST00000065405
Sequence
GCGCTCTCCTTGTCGCCCGGCTCTAGGCGGTTCCGTTAGCGGCGGGAGGGAAAACCGCCCCCGGCGTCCCCGCCTCCGCTGCTAACGCTTTCCTCCCTAC

TCCCCCTGCGACCACCCCGCAGCCCGCTACGGAGGCCCCCGAAGTACAAACGTCCCCCACGCTCCGAGCCCCATCGGAGGCTGAGTCCAGTCTAACTCCT

CGGGCCCTAAGCTCATTTTTTTTTCATTGTTTTTTGTTGTTGTTGTTTCTTGTTTTTCTTTTGGTCAGGAATTCGCTCTGGTGAGTTCCCTAAGGCGGCA

GAAACTTCAGCCTCTTCACGGTAGTAAAAGTTGGTTTCCCCTCCCCCGCTGCCGCCCAGGCCTCCCGCATTCCTTCCCTCCCGCCTCTCCGGATCGGGGC

GGGCGGGGGAGGAGGGAGCCAGAGCGCCTGCGCAGGGAGGCCGCTTTCCATCCGGGTCCCTGTCCGTGCGGTGCAGCAGGTCGGTAGGCGGGAAATGGCG

ACTGGCTGAAGGAGCTGGTTCTGTTGCTGCTGAGGGATAAGCGGGAAAGACACCACCTATTGCGCAGTCGGGACCATCGCCGGAGCCCGAAGACACTTTT

CTGTCGTCACAGTGAAG - UNI3860 - - UNI15164 - - UNI22158 - GTTTACATGTGGCACCCGTAAAAGATGAAGCTGAGAACACGGAA

GGCTTCTCAGCAGTCCAGTCCAATCCAGACACAGCGCACTGCCAGAGCAAAGAGGAAATACTCAGAGGTTGATGATAGCTTGCCTTCAGGAGGAGAAAAA

CCATCAAAGAATGAAACCGGCTTATTGTCTTCAATTAAAAAGTTCATTAAAGGAAGCACACCCAAG - UNI1125 - - UNI18234 - - UNI221

58 - GAAGAGAGAGAAAATCCTTCGAAGCGGAGTAGAATTGAACGTGATATAGATAATAATTTAATCACATCAACACCAAGAACCGGAGAAAAGCCTGA

CAAACAGTTGTCTCGAGTAAGACGGAAAAGTCCAGTCAATGGAG - UNI6009 - - UNI24977 - GAACGTCAGGCTCAGATTCCCCAGGACAGG

CTGTGGAAGCTGAGGAGATAGTGAAACAACTTGACATGGAACAGGTGGATGAAATTACTACCAGCACCACGTCAGCTAATGGAGCGGCTTACTCAAATCA

AGCAGTTCAAGTGAGGCCATCACTAAATAATGGTTTAGAAGAAGCAGAAGAAACAGTTACCCGGGATATCCCACCCCTTACAG - UNI4489 - CACC

AGTAACTCCAGAGAGTGGGTACTCGTCAGCCCATGCAGAGGCCACCTATGAAGAAGACTGGGAAGTATTTGACCC CTATTATTTCATCAAACATGTTCC

GCCTCTGACAGAAGAACAGCTAAATAGGAAACCTGCTCTTCCTTTGAAAACAAGAAGCACACCAGAGTTCTCCCTGGTCTTAGATCTG - UNI3259 -

 - UNI19722 - GATGAGACACTAGTGCACTGCAGTCTGAATGAGCTAGAAGATGCAGCGCTCACTTTTCCAGTCCTTTTCCAAGATGTCATTTATCA

GGTAATTTTAAGCCTAATTTTTAAACCATTAGGTAACATTCTGAGTGAAGAAAATTTTTTTTGTGATGTTCAGTGTGTCTTTCTGTAG
Translation
 - UNI3860 - - UNI15164 - - UNI22158 - MKLRTRKASQQSSPIQTQRTARAKRKYSEVDDSLPSGGEKPSKNETGLLSSIKKFIKGSTP

K - UNI1125 - - UNI18234 - - UNI22158 - EERENPSKRSRIERDIDNNLITSTPRTGEKPDKQLSRVRRKSPVNGG - UNI6009 - 

- UNI24977 - GTSGSDSPGQAVEAEEIVKQLDMEQVDEITTSTTSANGAAYSNQAVQVRPSLNNGLEEAEETVTRDIPPLTA - UNI4489 - AP

VTPESGYSSAHAEATYEEDWEVFDP PYYFIKHVPPLTEEQLNRKPALPLKTRSTPEFSLVLDL - UNI3259 - - UNI19722 - DETLVHCSLN

ELEDAALTFPVLFQDVIYQVILSLIFKPLGNILSEENFFCDVQCVFL

For any suggestions or comments, please send an email to unitrap@crg.es