Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033439 (Ccdc76)
Chromosomal location
Chr 3: 116284254 - 116317505 (-)
Description
coiled-coil domain containing 76 Gene [Source:MGI Symbol;Acc:MGI:1925219]
RefSeq_dna
NM_030016 
RefSeq_peptide
NP_084292.1 
UniGene
Mm.259648 
MGI
MGI:1925219 
Uniprot/SWISSPROT
Q8BYH3 
Human Ortholog
ENSG00000122435 (CCDC76)
Omim not available
UniTrap UNI19507
Vector Insertion
Chr 3: 116298512 - 116316676
Public Clones (sanger) IST13398C4 (tigm) IST12970G2 (tigm) IST14113B3 (tigm) IST12026B4 (tigm)
IST14284D6 (tigm) IST12364H8 (tigm)
Private Clones OST389965 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26190
Vector Insertion
Chr 3: 116295429 - 116297556
Public Clones not available
Private Clones OST131870 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22127
Vector Insertion
Chr 3: 116295178 - 116295381
Public Clones not available
Private Clones OST307643 (lexicon)
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1698
Vector Insertion
Chr 3: 116291558 - 116292408
Public Clones CF0701 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 35% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5097
Vector Insertion
Chr 3: 116288189 - 116288672
Public Clones YTC687 (baygenomics) CSG072 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041524
Sequence
GAGTAACAACAGAACTCTGTGTTGCAGCCTCAGCATCTCTGCAGTGAGGTTAAGGGTGGCACCTAAATACGGGGTTCATTTCTGGAAGTCACTTCCACAG

TGTCTGTGGTTACCTCGCACATGCTCAGTAAGCAACAGCTACTGTCTAGCAGTAGTATCCTCACTGGTCGTTCCACTTCATAGAGCTGCTGGACTACACT

TGCCAACGCTGTGAGACACAGACACTGCAGTAATATTAAAAGGAACTGAAAGGATCTGAGGGCTGCTCCCGTGAATATTCCAACTCCACACTAAAATACC

CAGTCTGTTTCCATGCTGTCCTGAACCAGCTCCGTCATCACACTTGCCACTCCCTGTTTTCTCTGCAGTGAGATGATCACTGTAGGGACAGAAGTTCTGT

GCAGAGCATCCAAGGGAACAGCAGCCACTGAGCAGCACAGTAGCCACACTAAAGCCGAGGGAGCCCGCAACAGCAGCCAGCACGGGATACCTCTTCCACG

CCAGCCAGCTTCGCCTTTAGCTCTCGGACAGTCGAGTCTCCTTTATACTTCCTCTCGGTGAGCTCTTTATTAGCTGCCTCTAACTCGGACAATCTGCTTT

GTAGCTGGTGGATATTCCGTTGATGGAGGGTTTCCAGTTCCTTTTTCTGTTGCTCGTGCTGCTGTTGGCACTGAACTTGGGTCTATTATAGAGCAGTATG

TCAAAGGAGAAAGAGCAGAAGTATAAAGATCAGAAAAAACAAAACATCATTTCTTCATCCTAATTTCTTCATCGTTTTCCAATTTCCCTGCTTAGAAGAA

GTCTAATTACAGATTTCACGAAAGAGCAG - UNI19507 - ATGGAGTTCTAAAGCTTCACCCCCAGTGTTCTTCAAAGGAGAGCATGAGTGAAGGGC

CGGGCGACCTGAATCCTAGTGCGGACAGCTCCCTGAAGTCACCGTGAAGCTTTTGTGGAAATGACAGGGAGAATCAGAGTTGCCACCCAGAAAGGACAGG

CTGGGCTCTGTCCCGCTGAGGGCCAGAACACGGACGTGAAGGAGTCGGCTTGCCATTTCCTCATTCCCTTTCCTCGCGTCCCCTCCGCAACGGCCGGCCC

GGCCACAAACAAAGGTATCCATTAAGTCCGCAGGGTCCCTTCCCGATTCCCGGTGTGACAGTCCGACACCCGCGGACCGACCGATCCCCACGGAACCCAG

CCGCCATCTTCCCCATTGGCGCGACCCCAACCGCCACCCGCCGGCTCCGGGAGCTCACCTCTCCTCGCAGTCTTTGCATTTCACTAGCAAGGGAACAAGC

TGCTGGAACAGAACTTGACTCATGTCGGACCGCTGCCCCGACGGGAGGGTGAAGAAGCCCAGTAGGCCCGGCCTTCGGTCCCGGCTGCAAAGAAGAGCCG

GTCCCGATGAGTTTGAGTTTGGCGCTCAGCTCCCGCGGAGGAGGAGGGAAACGATAAACAGAGGGAACGAAGGAGCTTTGGACCTCGTCAGCCACCGTCA

CCTTTTTCCGGTTCGGGCACCGACCGAGCCGGGCTGATGCGTCATTTCCGTGGACCCACCCCCCTCAGGCGGCCACGTTTGTTAAGGGAAGTGGGACCAA

AGGGGACTGACAACTTTGGGCTGAGCCAGGCTTTCAAAAGGACCCAGCGTTATGGAGGCTCCGGCGGCGACTTCGCCCTCGATCGGATTTCCCATCGACG

GCAGATGCAACTACTTCGTAGAAAAGAAGAAGCGCTTCTGCAGGATGGTGGCGGCCGCGGGGAAAAGGTTCTGTGGCGAACACGCTGGCTCCGCCGAG -

 UNI26190 - GAAGAAAATACTCGGAAAAGAATCTTGTGTCCTTTAGATCCAAAACA - UNI22127 - CACAGTGTATGAAGACCAACTAGCAAA

ACATTTGAAAAAATGTAATTCAAGAGAGAAGCCTAAGCCT GATTTCTTTATTCAAGATATAAATGCAGGATTAAAGGATGAAACAGAGATTCCTGAGCA

ATTA GTTCCATTTTCTTCTCTATCTGAAGAGCAGTTGGAGAACTTAATTAAGAAATTGAGAAAAGCAAGTGAAG GCTTGAATTCTACACATGAAGATC

ACATCATGTCCCATCCAGCATTGCATGATGCCCTTAATGACCCAAGGAATGGCGATTGTGCAGTCAAACACCTGAAACAGCAG - UNI1698 - GCTT

CTATTCTAGGCAACATTGAAAAGTTAAAGTTACTTGGCCCAAGAAGATGCTTTGTTGAGTTTGGAGCAGGAAAGGGGAAATTATCTCACTGGGTTGATAT

TGCCTTAAAAGATGCTGAAAATGTTCACTTCATCCTGGTAGAAAGAGTGACCACAAGATTCAAG GTAGATGGTAAACACAGAAAAAAGGACTCAGTGTT

TGAAAGGCTTCAAATTGATATCCAGCACTTGTGTTTGA - UNI5097 - ACAGGGTTCCTGTGCTAAGAGAAGGAAGACTGCCCGTGGTAGGAATTGG

GAAGCACCTGTGTGGGGTGGCGACAG ATGTTGCATTACGATGTTTGGTTGAAACCTATGCTGCCAGTTTTGAGGAAAAGGATGAAGAACCTTTAGCCAA

ACGCATAAAGAATGATAAGACAGAAAAAGAAAGTAACACTTTGGCCAAGGAAGGAAGTGAAAAAGATGTCCCAGAGACATGGACCCCGGTGGCTGGCATT

GTGATTGCGCTCTGTTGTCACCACAGGTGTGACTGGAGACATTATGTGGGCAAAGAGTATTTCAAGGCTCTTGGACTTGGGGCGGTAGAGTTCTACTATT

TCCAGAGAATGAGTAGTTGGGCAACGTGTGGAATGAGGACATCGTTGGAAGGCTCGGATGTTACTCCAGAGAGAAAAGATGCTCAAAGGGATGAGAATGA

AGAGCACGATGATGGAGGAGACAGACTCACAGATGGCAACACTGACAGTTTGCCTGG GATTCTTACTGTTGAAGAAAAGAAGAAAATAGGACATCTTTG

TAAACTGCTGATTGACCAAGGCAGACTCCAGTATTTACAGCAGAAAGGCTTCAGTCCTGCCTTACAGTACTATACGGACCCATTGGTGTCTCTGGAAAAC

GTATTATTAACTGCCGTACCAGCTCATCCGTCATCGCAGGAAAAACATCATCAATGAAAGGAAACATGAACGTGACGTTTGTCTTCCACAAACAAAAAAA

TTTAAATTATTTTTAAATTATATTTCGATATTC
Translation
 - UNI19507 - MEAPAATSPSIGFPIDGRCNYFVEKKKRFCRMVAAAGKRFCGEHAGSAE - UNI26190 - EENTRKRILCPLDPKH - UNI2

2127 - HTVYEDQLAKHLKKCNSREKPKP DFFIQDINAGLKDETEIPEQL VPFSSLSEEQLENLIKKLRKASEG GLNSTHEDHIMSHPALHDALND

PRNGDCAVKHLKQQ - UNI1698 - ASILGNIEKLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAENVHFILVERVTTRFK VDGKHRKKDSVFERLQ

IDIQHLCLN - UNI5097 - NRVPVLREGRLPVVGIGKHLCGVATD DVALRCLVETYAASFEEKDEEPLAKRIKNDKTEKESNTLAKEGSEKDVPET

WTPVAGIVIALCCHHRCDWRHYVGKEYFKALGLGAVEFYYFQRMSSWATCGMRTSLEGSDVTPERKDAQRDENEEHDDGGDRLTDGNTDSLPG GILTVE

EKKKIGHLCKLLIDQGRLQYLQQKGFSPALQYYTDPLVSLENVLLTAVPAHPSSQEKHHQ

For any suggestions or comments, please send an email to unitrap@crg.es