Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033498 (Strc)
Chromosomal location
Chr 2: 121189463 - 121206676 (-)
Description
stereocilin Gene [Source:MGI (curated);Acc:Strc-001]
RefSeq_dna
NM_080459 
RefSeq_peptide
NP_536707.2 
UniGene
Mm.472304 
MGI
MGI:2153816 
Uniprot/SWISSPROT
Q8VIM6 
Uniprot/SPTREMBL
A2ARP7 Q3UMD0 
Human Ortholog
ENSG00000166763 (STRC)
Omim 603720 - DEAFNESS, AUTOSOMAL RECESSIVE 16  611102 - DEAFNESS, SENSORINEURAL, AND MALE INFERTILITY  
UniTrap UNI34194
Vector Insertion
Chr 2: 121199285 - 121200148
Public Clones IST12002E11 (tigm) IST12393E2 (tigm) IST12378E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038389
Sequence
GCCCCGTCTTCACCTGGCTATCCCTTCATGGTGAGCATAGCCAGAACTCACCTCTAGGCCCAGTGTGCACCTGGAAATATGGCTCTGAGCCTCCAGCCCC

AGCTGCTCCTTCTCCTGTCGCTCCTGCCGCAGGAAG TGACTTCAGCCCCTACTGGGCCTCAGTCTTTGGATGCTGGTCTCTCCCTTCTGAAGTCATTCG

TAGCCACTCTGGACCAAGCTCCTCAGCGTTCCCTCAGCCAGTCACGGTTCTCTGCGTTCCTGGCCAACATTTCTTCATCCTTCCAGCTTGGGAGGATGGG

GGAGGGACCGGTGGGAGAGCCCCCACCTCTCCAGCCCCCTGCACTTCGACTTCATGATTTCCTCGTGACACTGAGAGGTAGCCCAGACTGGGAGCCAATG

CTAGGGCTTCTGGGAGATGTGCTGGCACTCCTGGGACAGGAACAGACTCCCCGGGACTTTTTGGTGCACCAGGCAGGTGTACTGGGTGGACTTGTAGAGG

CATTGTTGGGAGCGTTAGTTCCTGGAGGCCCCCCTGCCCCCACTCGACCCCCATGCACCCGTGATGGCCCTTCTGACTGTGTCCTGGCTGCTGATTGGTT

GCCTTCTCTGATGTTGTTATTAGAGGGTACACGCTGGCAGGCCCTGGTGCAGTTGCAGCCCAGTGTGGACCCAACCAATGCCACAGGTCTTGATGGTAGA

GAGCCAGCTCCTCACTTTTTACAGGGTCTGCTGGGCTTGCTTACCCCAGCAGGAGAGTTGGGCTCTGAGGAGGCTCTTTGGGGTGGTCTGCTGCGCACAG

TGGGGGCCCCCCTCTATGCTGCCTTCCAGGAGGGGCTACTGCGAGTCACTCATTCTCTGCAAGATGAGGTCTTTTCTATTATGGGACAGCCAGAGCCTGA

TGCCAGTGGGCAGTGCCAGGGAG GCAACCTTCAACAGCTGCTTTTATG GGGCATGCGGAACAACCTTTCTTGGGACGCCCGAGCACTGGGTTTTCTAT

CTGGATCACCACCTCCACCCCCTGCTCTCCTGCACTGCCTGAGCAGAGGTGTGCCTCTGCCCAGGGCTTCCCAGCCTGCGGCTCACATCAGCCCTCGACA

GCGGCGAGCCATCTCTGTGGAGGCCCTCTGCGAGAACCACTCAGGCCCAGAGCCACCCTACAGCATCTCCAACTTCTCCATCTACTTGCTCTGCCAGCAC

ATCAAGCCTGCCACCCCGCGGCCCCCTCCTACCACCCCACGGCCTCCTCCTACCACCCCACAGCCCCCTCCTACCACTACACAGCCCATTCCTGACACTA

CACAGCCCCCTCCTGTCACCCCAAGGCCTCCTCCTACCACCCCACAACCCCCTCCTAGCACAGCTGTCATCTGCCAGACAGCTGTATGGTACGCAGTCTC

GTGGGCACCAGGTGCCCGAGGTTGGCTCCAAGCCTGCCATGATCAGTTTCCTGATCAATTTCTGGATATGATCTGCGGCAACCTCTCATTTTCAGCCCTG

TCTGGCCCCAGTCGTCCTTTGGTAAAGCAGCTCTGTGCTGGCTTGCTCCCACCCCCCACTAGCTGTCCACCAGGCCTGATCCCTGTGCCCCTCACCCCAG

AAATATTCTGGGGCTGTTTCCTGGAGAATGAGACACTGTGGGCTGAACGGTTGTGTGTGGAGGACAGTCTGCAGGCTGTGCCCCCGAGGAACCAGGCTTG

GGTTCAGCATGTGTGTCGGGGCCCCACCTTGGACGCCACTGATTTTCCACCGTGCCGCGTTGGACCCTGTGGGGAACGCTGCCCAGATGGGGGCAGCTTC

CTGCTCATGGTCTGTGCCAATGACACTCTGTATGAAGCCTTGGTTCCCTTCTGGGCTTGGCTAGCAGGCCAATGCAGAATTAGTCGTGGAGGAAATGATA

CTTGCTTTCTAGAAGGCATGCTGGGCCCCTTGTTGCCCTCTCTGCCCCCTCTGGGACCATCCCCACTCTGTCTGGCTCCTGGTCCTTTTCTGCTTGGCAT

GTTATCCCAGTTGCCACGCTGTCAGTCCTCCGTGCCAGCCCTCGCCCACCCCACGCGCCTACATTACCTCCTGCGCCTACTGACCTTCCTTCTGGGTCCA

GGGACTGGGGGTGCCGAGACGCAGGGGATGTTAGGTCAAGCCCTGCTGCTCTCTAGTCTCCCAGACAACTGTTCATTCTGGGATGCCTTCCGCCCAGAGG

GCCGGAGAAGTGTACTGAGGACAGTCGGAGAGTACTTGCAGCGGGAAGAGCCAACCCCACCAGGCTTAGACTCCTCCCTCAGCCTCGGCTCTGGTATGAG

CAAGATGGAGCTTCTGTCCTGCTTCAGT CCTGTACTGTGGGATCTACTCCAGAGAGAGAAGAGCGTTTGGGCCCTGAGGACCCTGGTGAAG GCCTACC

TGCGCATGCCTCCAGAAGACCTTCAGCAGCTTGTGCTTTCAGCAGAGATGGAGGCTGCACAGGGCTTCCTGACGCTCATGCTTCGTTCCTGGGCTAAGCT

GAAG GTTCAACCATCCGAGGAGCAGGCCATGGGCCGCCTGACAGCCTTGCTGCTCCAGCGGTACCCACGCCTCACCTCCCAACTCTTTATCGACATGTC

ACCGCTCATCCCCTTCCTGGCTGTCCCTGACCTCATGCGCTTCCCACCGTCCCTTTTGGCCAACGACAGTGT CCTGGCTGCCATCAGGGATCACAGCTC

AGGAATGAAGCCTGAACAGAAGGAGGCCCTGGCAAAACGACTGCTGGCCCCTGAGCTGTTTGGAGAAGTGCCTGATTGGCCCCAGGAGCTGCTGTGGGCA

GCCCTGCCTCTGCTTCCCCATCTGCCTCTGGAGAGCTTTCTCCAGCTCAGCCCTCACCAG ATCCAGGCCCTGGAGGATAGCTGGCCAGTAGCAGATCTT

GGGCCGGGACACGCCCGACATGTGCTTCGTAGCCTAGTAAACCAGAGCATGGAGGATGGGGAGGAGCAGGTGCTCAG - UNI34194 - GCTTGGGTC

CCTCGCCTGTTTCCTGAGTCCTGAGGAGCTACAGAGTCTGGTGCCCTTGAGTGATCCAATGGGGCCTGTAGAACAGGGTCTGCTGGAATGTGCGGCCAAT

GGGACCCTCAGCCCAGAAGGACGG - UNI34194 - GTGGCATATGAACTTCTGGGAGTGTTGCGTTCATCTGGAGGAACTGTCTTAAGCCCCCGAGA

GCTGAGGGTCTGGGCACCTCTCTTTCCCCAGCTGGGCCTCCGCTTCCTGCAGGAGCTCTCAGAGACCCAGCTTAGAGCCATGCTTCCTGCCCTACAGGGA

GCCAGTGTCACACCTGCCCAG - UNI34194 - GCTGTTCTGTTGTTTGGAAGGCTCCTTCCTAAGCATGAT CTGTCCCTGGAGGAACTCTGCTCCC

TGCACCCTCTCCTGCCAGGTCTCAGCCCCCAGACACTCCAGGCCATCCCTAAGAGAGTTCTGGTTGGTGCTTGTTCCTGCCTGGGCCCTGAACTGTCAAG

GCTTTCAGCTTGCCAGATTGCAGCTCTGCTGCAGACCTTTCGG GTAAAAGATGGTGTTAAAAATATGGGTGCAGCAGGTGCCGGCTCAGCCGTGTGCAT

TCCTGGGCAG CCCACCACTTGGCCAGACTGCCTGCTTCCCCTGCTCCCATTAAAGCTGCTACAGCTGGACGCTGCAGCTCTTCTGGCAAACCGAAGACT

CTATCGGCAGCTGCCTTGGTCTGAGCAACAG GCACAGTTTCTCTGGAAGAAAATGCAAGTGCCTACCAACCTGAGCCTGAGGAATCTGCA GGCTCTGG

GCAACTTGGCAGGAGGCATGACCTGCGAGTTTCTGCAGCAGATCAGCTCAATGGTTGACTTTCTTGATGTGGTACACATGCTCTACCAGCTGCCCACTGG

TGTTCGAGAGAGCCTG CGGGCCTGTATCTGGACAGAGCTACAGCGGAGGATGACAATGCCAGAGCCAGAGCTGACCACCCTAGGGCCAGAACTGAGTGA

ACTTGACACAAAGCTACTCCTGGACTTGCC GATCCAGCTGATGGACAGATTGTCCAATGATTCCATTATGTTGGTGGTGGAGATGGTCCAAGGCGCTCC

AGAGCAGCTGCTGGCACTGACCCCACTCCACCAGACAGCCTTGGCAGAGCGAGCACTTAAAAACCTG GCTCCAAAGGAGACCCCAATCTCCAAAGAAGT

GCTGGAGACACTGGGCCCCTTGGTTGGATTCCTGGGAATAGAGAGCACGCGACGGATCCCTTTACCCATTCTACTGTCTCATCTCAGTCAGCTGCAGGGC

TTCTGCCTAGGAGAGACATTTGCCACAGAGCTGGGATGGCTGCTGTTGCAGGAGCCTGTTCTTGG AAAACCAGAATTGTGGAGCCAGGATGAAATAGAG

CAAGCTGGACGCCTAGTATTCACTCTGTCTGCTGAGGCTATTTCCTCGATCCCCAGG GAGGCTTTGGGCCCAGAGACACTGGAGAGGCTTCTGGGAAAG

CATCAAAGCTGGGAGCAGAGCAGAGTGGGCCATCTGTGTGGGGAGTCACAGCTTGCCCACAAGAAAGCAGCTCTGGTAGCTGGGATTGTGCATCCAGCTG

CTGAGGGTCTCCAAG AGCCTGTACCAAACTGTGCAGACATACGGGGAACCTTCCCAGCGGCCTGGTCTGCGACACAAATCTCAGAGATGGAACTCTCAG

ACTTTGAAGACTGCCTGTCACTATTTGCTGGAGATCCAGGACTTGGTCCTGAGGAACTACGGGCAGCCATGGGCAAGGCCAAGCAG TTGTGGGGTCCCC

CTCGAGGATTCCGTCCTGAGCAGATCTTGCAGCTGGGCCGTCTCCTGATAGGTCTAGGAGAACGGGAACTGCAGGAGCTTACCTTGGTGGACTGGGGTGT

GCTGAGCAGCCTGGGGCAAATAGATGGCTGGAGTTCCATGCAG CTCCGAGCCGTGGTCTCCAGTTTCCTAAGGCAGAGTGGTCGGCATGTGAGCCACCT

GGACTTCATTTATCTGACAGCACTGGGTTACACAGTCTGTGGATTGCGACCAGAGGAGTTACAGCACATCAGCAGTTGGGAGTTTAG CCAAGCAGCTCT

CTTCCTGGGTAGCTTGCATCTCCCGTGCTCTGAGGAACAGCTGGAAGTTCTGGCCTATCTCCTTGTGTTGCCTGGTGGCTTTGGCCCAGTCAGTAACTGG

GGGCCTGAGATCTTCACTGAAATTGGCACAATAGCAG CTGGCATCCCAGACCTGGCTCTTTCAGCATTACTGCGGGGACAGATCCAAGGCCTGACTCCT

CTTGCCATTTCTGTCATTCCTGCTCCCAAGTTTGCA GTGGTCTTCAACCCCATCCAGTTATCTAGTCTCACCAGGGGTCAGGCCGTAGCTGTTACTCCT

GAACAGCTGGCCTATCTGAGTCCTGAGCAGCGGCGAGCAGTTGCATGGGCCCAACACGAAGGGAAGGAGATCCCAGAGCAGCTGG GTCGAAACTCAGCC

TGGGGTCTCTACGACTGGTTCCAAGCCTCCTGGGCCCTGGCATTGCCCGTCAGCATTTTTGGCCACCTATTATGATAACTGTTCCTTCAGTTGAGGGAGA

AAATTTACATCATACTGAACAACTTGTAAATGGAAGTGCATACTAATTATTCTCAGTAAGTGGATGAGGATTGTGGGTAAAATTCCAATGCATTCCACCC

ACCTGAGAACTGTGCTCCTGGCATATACGCCTCTTGCCATCATGAATAACCTCACTGTTTCTTTTCATTTCCTACTTCCTCCTCACCACACCAATAGAAA

TAACACAGACAGCTGCAACATAAT
Translation
MALSLQPQLLLLLSLLPQEV VTSAPTGPQSLDAGLSLLKSFVATLDQAPQRSLSQSRFSAFLANISSSFQLGRMGEGPVGEPPPLQPPALRLHDFLVTL

RGSPDWEPMLGLLGDVLALLGQEQTPRDFLVHQAGVLGGLVEALLGALVPGGPPAPTRPPCTRDGPSDCVLAADWLPSLMLLLEGTRWQALVQLQPSVDP

TNATGLDGREPAPHFLQGLLGLLTPAGELGSEEALWGGLLRTVGAPLYAAFQEGLLRVTHSLQDEVFSIMGQPEPDASGQCQGG GNLQQLLLW WGMRN

NLSWDARALGFLSGSPPPPPALLHCLSRGVPLPRASQPAAHISPRQRRAISVEALCENHSGPEPPYSISNFSIYLLCQHIKPATPRPPPTTPRPPPTTPQ

PPPTTTQPIPDTTQPPPVTPRPPPTTPQPPPSTAVICQTAVWYAVSWAPGARGWLQACHDQFPDQFLDMICGNLSFSALSGPSRPLVKQLCAGLLPPPTS

CPPGLIPVPLTPEIFWGCFLENETLWAERLCVEDSLQAVPPRNQAWVQHVCRGPTLDATDFPPCRVGPCGERCPDGGSFLLMVCANDTLYEALVPFWAWL

AGQCRISRGGNDTCFLEGMLGPLLPSLPPLGPSPLCLAPGPFLLGMLSQLPRCQSSVPALAHPTRLHYLLRLLTFLLGPGTGGAETQGMLGQALLLSSLP

DNCSFWDAFRPEGRRSVLRTVGEYLQREEPTPPGLDSSLSLGSGMSKMELLSCFS PVLWDLLQREKSVWALRTLVK AYLRMPPEDLQQLVLSAEMEAA

QGFLTLMLRSWAKLK VQPSEEQAMGRLTALLLQRYPRLTSQLFIDMSPLIPFLAVPDLMRFPPSLLANDSV VLAAIRDHSSGMKPEQKEALAKRLLAP

ELFGEVPDWPQELLWAALPLLPHLPLESFLQLSPHQ IQALEDSWPVADLGPGHARHVLRSLVNQSMEDGEEQVLR - UNI34194 - RLGSLACFLS

PEELQSLVPLSDPMGPVEQGLLECAANGTLSPEGR - UNI34194 - VAYELLGVLRSSGGTVLSPRELRVWAPLFPQLGLRFLQELSETQLRAMLPA

LQGASVTPAQ - UNI34194 - AVLLFGRLLPKHD LSLEELCSLHPLLPGLSPQTLQAIPKRVLVGACSCLGPELSRLSACQIAALLQTFR VKDGV

KNMGAAGAGSAVCIPGQ PTTWPDCLLPLLPLKLLQLDAAALLANRRLYRQLPWSEQQ AQFLWKKMQVPTNLSLRNLQ QALGNLAGGMTCEFLQQISS

MVDFLDVVHMLYQLPTGVRESL RACIWTELQRRMTMPEPELTTLGPELSELDTKLLLDLP PIQLMDRLSNDSIMLVVEMVQGAPEQLLALTPLHQTAL

AERALKNL APKETPISKEVLETLGPLVGFLGIESTRRIPLPILLSHLSQLQGFCLGETFATELGWLLLQEPVLG GKPELWSQDEIEQAGRLVFTLSAE

AISSIPR EALGPETLERLLGKHQSWEQSRVGHLCGESQLAHKKAALVAGIVHPAAEGLQE EPVPNCADIRGTFPAAWSATQISEMELSDFEDCLSLFA

GDPGLGPEELRAAMGKAKQ LWGPPRGFRPEQILQLGRLLIGLGERELQELTLVDWGVLSSLGQIDGWSSMQ LRAVVSSFLRQSGRHVSHLDFIYLTAL

GYTVCGLRPEELQHISSWEFS SQAALFLGSLHLPCSEEQLEVLAYLLVLPGGFGPVSNWGPEIFTEIGTIAA AGIPDLALSALLRGQIQGLTPLAISV

IPAPKFA VVFNPIQLSSLTRGQAVAVTPEQLAYLSPEQRRAVAWAQHEGKEIPEQLG GRNSAWGLYDWFQASWALALPVSIFGHLL

For any suggestions or comments, please send an email to unitrap@crg.es