Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033581 (Igf2bp2)
Chromosomal location
Chr 16: 22059149 - 22163107 (-)
Description
insulin-like growth factor 2 mRNA binding protein 2 Gene [Source:MGI (curated);Acc:Igf2bp2-001]
RefSeq_peptide
NP_898850.2 
UniGene
Mm.294740 
MGI
MGI:1890358 
Uniprot/SWISSPROT
Q5SF07 
Uniprot/SPTREMBL
A6X8Z3 A6X8Z4 
Human Ortholog
ENSG00000073792 (IGF2BP2)
Omim not available
UniTrap UNI25729
Vector Insertion
Chr 16: 22161524 - 22162858
Public Clones not available
Private Clones OST168874 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30317
Vector Insertion
Chr 16: 22121269 - 22161380
Public Clones (sanger) D016G06 (ggtc) IST14111H10 (tigm) IST14099G8 (tigm) IST12923B5 (tigm)
IST10208C8 (tigm) IST10745E10 (tigm) IST12126B4 (tigm) IST10908D5 (tigm)
IST12769B8 (tigm) IST10594D3 (tigm) IST15098A3 (tigm) IST12911A8 (tigm)
IST12931H6 (tigm) IST14541E2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13456
Vector Insertion
Chr 16: 22089184 - 22121269
Public Clones (sanger) D071E01 (ggtc) D183E12 (ggtc) CMHD-GT_517H12-3 (cmhd) CMHD-GT_437A6-3 (cmhd)
CMHD-GT_252B01-3 (cmhd) CMHD-GT_448A6-3 (cmhd) FHCRC-GT-S14-3A1 (fhcrc) IST10030C1 (tigm)
IST15105C6 (tigm) IST13050G8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18275
Vector Insertion
Chr 16: 22087653 - 22089134
Public Clones not available
Private Clones OST426610 (lexicon) OST416476 (lexicon) OST173265 (lexicon) OST104649 (lexicon)
OST66321 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31699
Vector Insertion
Chr 16: 22081806 - 22084061
Public Clones IST14697F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25545
Vector Insertion
Chr 16: 22080275 - 22081806
Public Clones not available
Private Clones OST177549 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25625
Vector Insertion
Chr 16: 22070449 - 22076089
Public Clones CMHD-GT_536B12-5S (cmhd)
Private Clones OST173259 (lexicon) OST60970 (lexicon)
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20539
Vector Insertion
Chr 16: 22068333 - 22070379
Public Clones not available
Private Clones OST359379 (lexicon) OST314128 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041504
Sequence
ATGCATCCTTCACAGTGGCCAAGGTATGGGGCCGCAGGGAAGCCCTTCAGCAG - UNI13456 - - UNI30317 - GAGCAGAAGAATCCAGATTC

GGAACATCCCGCCTCACCTGCAGTGGGAG - UNI18275 - GTGTTGGATGGGCTGTTGGCTGAATATGGGACAGTGGAGAACGTGGAGCAAG - UN

I31699 - TCAACACAGATACAGAAACTGCCGTTGTCAACGTCACCTATATGACAAGAGAAGAGGCAAAGCT - UNI31699 - AGCTATTGAGAAG

CTCAGTGGGCATCAGTTTGAGGACTACTCCTTCAAGATTTCCTACATCCCCGATGAAGAGGTGAGCTCTCCTTCACCCCCTCATCGTGCCCGGGAACAAG

GCCACGGCCCCGGGAGCTCTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGG

CTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCG - UNI25545 - - UNI31699 - GGTAGACATCCACAGAAAGGAGAACTCTGGGGCT

GCAGAGAAGCCTGTCACAATCCATGCTACCCCAGAAGGGACATCTGAAGCATGCCGCATGATTCTTGAGATTATGCAAAAAGAAGCTGATGAGACCAAAC

T GGCTGAGGAGGTTCCTCTGAAAATCCTGGCCCACAATGGCTTCGTTGGAAGACTGATTGGCAAAGAAGGCAGAAACCTGAAGAAAATAGAACATGAGA

CAGGGACCAAGATAACCATCTCATC CTTGCAGGATTTGAGCATTTATAACCCCGAGAGAACCATCACCGTGAGGGGCACCATTGAAGCCTGTGCCAATG

CTGAGATAGAGATTATGAAGAAGCTCCGAGAGGCCTTTGAGAACGACATGCTGGCCGTTAAC CAACAAGCCAATCTGATCCCAGGGCTAAACCTCAGTG

CACTTGGCATCTTTTCGACTGGACTGTCTGTGCTTCCTCCACCAGCAGGGCCCCGTGGAGTTCCCCCCAGTCCTCCCTATCACCCCTTTGCT - UNI25

625 - ACCCACTCCGGATACTTCTCCAGTCTGTACCCTCATCACCATTTCGGCCCATTCCCACATCATCACTCC - UNI20539 - TACCCAGAGCA

GGAGACTGTAAGTCTCTTCATCCCAACCCAGGCTGTGGGTGCTATCATCGGGAAGAAGGGGGCACACATCAAACAGCTCGCTCGATTTGCTGGTGCCTCC

ATCAAG ATTGCTCCAGCAGAAGGTCCAGATGTCAGTGAGAGGATGGTCATCATCACTGGTCCTCCTGAAGCCCAGTTTAAG GCTCAGGGACGGATCTT

TGGGAAACTGAAGGAAGAAAACTTCTTTAATCCCAAAGAAGAAGTGAAGCTGGAGGCCCACATCCGAGTCCCCTCGTCGACCGCTGGCCGGGTGATTGGC

AAGGGCGGGAAAACC GTGAACGAGCTGCAGAACTTGACAAGTGCAGAAGTTATCGTGCCTCGTGACCAAACGCCAGACGAGAATGAGGAAGTGATCGTC

AGAATTATCGGGCATTTTTTTGCTAGCCAG ACTGCACAACGCAAGATCAGGGAAATTGTACAGCAGGTGAAGCAGCAGGAGCAGAGATACCCTCAGGGA

GTCGCCCCACAGCGCAGCAAGTGAGGCTCCCACAGCACCAGCAAGCAACCGATGAATGTAGCCCTCCCAACACCTGACAGATGAGACCAAACAGCCAGCA

GATCGGGAGCAAACCAAAGAGCATCCCGAGGAGTGCGCAGTCTGCAGAGCAGCCAGGGCCTGCAGACCTCTACACATCCTGGGATCCAGGAGGGCACAGG

GAAGGCCAGGTTGTCCAGAAACACCGCTTGGCCTGCCCCCAGCTTCCCCTGGCTTCTGCAGGCATAACAGCCATCCACTGCCCATCCAACTCAGATTCTC

CTCAGTTCCCAGGACGCTATCCCTTTCGGTTGAACTAACATAGGTGAACATGCTCAAAGCAAAGCAAAATTCCTAGCCGTTTCTTTGTTGTGGAAAGTTG

TCTCTGTACATGTATGTACATATCAGAAGGGGAAGGATGTTAAGAAATGTGGCCTGTGGGTTACACAGGGTGCCTGCAGCGTTAATATATTTTAGAAATA

ATATATCAAATAACTCCACTAACAACAATTTTTACTCAGTGATTAATTTTGTTTTCTTTTTGAAGAGAAAGCAGGCTTTTCTAGACTTCCAAGAATAAAG

TATTGGGTGAGGTCCACTGGTATAGAAAGGAACTTTGAGCCACCCACACAAAAAATTCACTTGGAGGGAAATCTTGTCAAGGACACTTAATGGCAGTTGT

GGGTCACCTGTGTCTGTCAACAGAAGGGATACCGTCCCTGAGGAGGGGCCCTAGGCCCTGGTCACCTGTTTCTCCCACACACCCATTGCTCAGTTTCACA

GGTTTTTAAACTGATGATTTTTGGTTTGTTTTGTTTTTGTTTTTTGCATACTGCTATATAGTTCTGTCTCTCTCCTTATCTCCCTCCTAACCTTCCTCTG

TCTTCTTTACCCAAAATTCTTTTGAGTCCCTTCGTTCTTTTTCTGCTCCCCGTATCTATGCACCCCTCCCCTCCCCCCAGGCAAAGCAGTGCTCTGAATA

TCATACCACACACAAGGAACAAATGCGAACCACACAGACCAGCCTCAGCTTACACTCGGTTACTCAAGCGAACAAGAGTCGGCGGTACTTGTCCTAGCAT

TCGGAAGAGGAAAGCAGGATCCCAGCAAATAAACCAGCCAGCCAAACAAAGAAAAATCCCACAAAGAAAGAATGGACTCTCTCTCCATCTTGGTATACAA

GCCATCAACATTTAGTGAAATTCTTTCTTTCTTTAAAAATTTAAAGTGCAGGAAAATAGCAATTTATACGAGGTTGTTGGCCCAGGGCGTTAAATTTACA

GATTTTTTTTAAATGAGAAAAACACACAAATAAAAGCTACCTCAGGTGTTTTTTACCTCAGCACCTTGCTCTTGTGTTTCCCTTAGAGATTTTGTAAAAC

TGATAGTTGGAGCATTTTTTATTTTTTTAATAAAAATGAGTTGAAAAAAAAAAAAGATGAGCTGCCAGCCCCAAGCAGGCGGCAGCCCAGGTGTGCCGCA

GCTCTTCTGTCTTCCGCTAGCCAAGAGCCTACGTGGCCTTCTTGTGGACAAACCTAAAAATGTTTATTTTTTAAAAAGTGACAAAGAAAAACAGAGAATA

TTGGAGCCGTCCTGAATTTCAATAGGGTACGTGCCGTGAGGGCTTTTGCGCTGAAGGATGACCACATCCTGGTTATGTGAAGAAACCATGACACTACCAG

ACTGCGATGCCGGTTTCCTCTACTGCAAGCAGTGTTCTGTG
Translation
MHPSQWPRYGAAGKPFSR - UNI13456 - - UNI30317 - RSRRIQIRNIPPHLQWE - UNI18275 - VLDGLLAEYGTVENVEQV - UNI

31699 - VNTDTETAVVNVTYMTREEAKL - UNI31699 - LAIEKLSGHQFEDYSFKISYIPDEEVSSPSPPHRAREQGHGPGSSSQARQIDFPLR

ILVPTQFVGAIIGKEGLTIKNITKQTQSR - UNI25545 - - UNI31699 - RVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADET

KL LAEEVPLKILAHNGFVGRLIGKEGRNLKKIEHETGTKITISS SLQDLSIYNPERTITVRGTIEACANAEIEIMKKLREAFENDMLAVN QQANLIP

GLNLSALGIFSTGLSVLPPPAGPRGVPPSPPYHPFA - UNI25625 - THSGYFSSLYPHHHFGPFPHHHS - UNI20539 - YPEQETVSLFIPT

QAVGAIIGKKGAHIKQLARFAGASIK IAPAEGPDVSERMVIITGPPEAQFK AQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKT VN

ELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQ TAQRKIREIVQQVKQQEQRYPQGVAPQRSK
Transcript ENSMUST00000115379
Sequence
AGTTCGCCCAGCTGCGGCCGGGTGGAGACCCCTTGAAGGCTCCAGAAGGAGGAGCCCGAGCGCGGAGTAGTGTGCGAGCCCCTCCTTGACCCCCGCGGGT

TTGACTCTGGGAGGTTCTGAGTGCTTTAAATTTCTGTTTTAAAGGTAAAGTGGAATTGCATGGGAAAATCATGGAAGTTGACTACTCAGTCTCTAAAAAG

CTAAG - UNI13456 - - UNI30317 - GAGCAGAAGAATCCAGATTCGGAACATCCCGCCTCACCTGCAGTGGGAG - UNI18275 - GTGTT

GGATGGGCTGTTGGCTGAATATGGGACAGTGGAGAACGTGGAGCAAG - UNI31699 - TCAACACAGATACAGAAACTGCCGTTGTCAACGTCACCT

ATATGACAAGAGAAGAGGCAAAGCT - UNI31699 - AGCTATTGAGAAGCTCAGTGGGCATCAGTTTGAGGACTACTCCTTCAAGATTTCCTACATC

CCCGATGAAGAGGTGAGCTCTCCTTCACCCCCTCATCGTGCCCGGGAACAAGGCCACGGCCCCGGGAGCTCTTCTCAGGCCAGACAGATTGATTTCCCGC

TGCGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAACATCACTAAGCAGACCCAGTCCCG - UNI255

45 - - UNI31699 - GGTAGACATCCACAGAAAGGAGAACTCTGGGGCTGCAGAGAAGCCTGTCACAATCCATGCTACCCCAGAAGGGACATCTGAA

GCATGCCGCATGATTCTTGAGATTATGCAAAAAGAAGCTGATGAGACCAAACT GGCTGAGGAGGTTCCTCTGAAAATCCTGGCCCACAATGGCTTCGTT

GGAAGACTGATTGGCAAAGAAGGCAGAAACCTGAAGAAAATAGAACATGAGACAGGGACCAAGATAACCATCTCATC CTTGCAGGATTTGAGCATTTAT

AACCCCGAGAGAACCATCACCGTGAGGGGCACCATTGAAGCCTGTGCCAATGCTGAGATAGAGATTATGAAGAAGCTCCGAGAGGCCTTTGAGAACGACA

TGCTGGCCGTTAAC CAACAAGCCAATCTGATCCCAGGGCTAAACCTCAGTGCACTTGGCATCTTTTCGACTGGACTGTCTGTGCTTCCTCCACCAGCAG

GGCCCCGTGGAGTTCCCCCCAGTCCTCCCTATCACCCCTTTGCT - UNI25625 - ACCCACTCCGGATACTTCTCCAGTCTGTACCCTCATCACCAT

TTCGGCCCATTCCCACATCATCACTCC - UNI20539 - TACCCAGAGCAGGAGACTGTAAGTCTCTTCATCCCAACCCAGGCTGTGGGTGCTATCAT

CGGGAAGAAGGGGGCACACATCAAACAGCTCGCTCGATTTGCTGGTGCCTCCATCAAG ATTGCTCCAGCAGAAGGTCCAGATGTCAGTGAGAGGATGGT

CATCATCACTGGTCCTCCTGAAGCCCAGTTTAAG GCTCAGGGACGGATCTTTGGGAAACTGAAGGAAGAAAACTTCTTTAATCCCAAAGAAGAAGTGAA

GCTGGAGGCCCACATCCGAGTCCCCTCGTCGACCGCTGGCCGGGTGATTGGCAAGGGCGGGAAAACC GTGAACGAGCTGCAGAACTTGACAAGTGCAGA

AGTTATCGTGCCTCGTGACCAAACGCCAGACGAGAATGAGGAAGTGATCGTCAGAATTATCGGGCATTTTTTTGCTAGCCAG ACTGCACAACGCAAGAT

CAGGGAAATTGTACAGCAGGTGAAGCAGCAGGAGCAGAGATACCCTCAGGGAGTCGCCCCACAGCGCAGCAAGTGAGGCTCCCACAGCACCAGCAAGCAA

CCGATGAATGTAGCCCTCCCAACACCTGACAGATGAGACCAAACAGCCAGCAGATCGGGAGCAAACCAAAGAGCATCCCGAGGAGTGCGCAGTCTGCAGA

GCAGCCAGGGCCTGCAGACCTCTACACATCCTGGGATCCAGGAGGGCACAGGGAAGGCCAGGTTGTCCAGAAACACCGCTTGGCCTGCCCCCAGCTTCCC

CTGGCTTCTGCAGGCATAACAGCCATCCACTGCCCATCCAACTCAGATTCTCCTCAGTTCCCAGGACGCTATCCCTTTCGGTTGAACTAACATAGGTGAA

CATGCTCAAAGCAAAGCAAAATTCCTAGCCGTTTCTTTGTTGTGGAAAGTTGTCTCTGTACATGTATGTACATATCAGAAGGGGAAGGATGTTAAGAAAT

GTGGCCTGTGGGTTACACAGGGTGCCTGCAGCGTTAATATATTTTAGAAATAATATATCAAATAACTCCACTAACAACAATTTTTACTCAGTGATTAATT

TTGTTTTCTTTTTGAAGAGAAAGCAGGCTTTTCTAGACTTCCAAGAATAAAGTATTGGGTGAGGTCCACTGGTATAGAAAGGAACTTTGAGCCACCCACA

CAAAAAATTCACTTGGAGGGAAATCTTGTCAAGGACACTTAATGGCAGTTGTGGGTCACCTGTGTCTGTCAACAGAAGGGATACCGTCCCTGAGGAGGGG

CCCTAGGCCCTGGTCACCTGTTTCTCCCACACACCCATTGCTCAGTTTCACAGGTTTTTAAACTGATGATTTTTGGTTTGTTTTGTTTTTGTTTTTTGCA

TACTGCTATATAGTTCTGTCTCTCTCCTTATCTCCCTCCTAACCTTCCTCTGTCTTCTTTACCCAAAATTCTTTTGAGTCCCTTCGTTCTTTTTCTGCTC

CCCGTATCTATGCACCCCTCCCCTCCCCCCAGGCAAAGCAGTGCTCTGAATATCATACCACACACAAGGAACAAATGCGAACCACACAGACCAGCCTCAG

CTTACACTCGGTTACTCAAGCGAACAAGAGTCGGCGGTACTTGTCCTAGCATTCGGAAGAGGAAAGCAGGATCCCAGCAAATAAACCAGCCAGCCAAACA

AAGAAAAATCCCACAAAGAAAGAATGGACTCTCTCTCCATCTTGGTATACAAGCCATCAACATTTAGTGAAATTCTTTCTTTCTTTAAAAATTTAAAGTG

CAGGAAAATAGCAATTTATACGAGGTTGTTGGCCCAGGGCGTTAAATTTACAGATTTTTTTTAAATGAGAAAAACACACAAATAAAAGCTACCTCAGGTG

TTTTTTACC
Translation
MEVDYSVSKKLR - UNI13456 - - UNI30317 - RSRRIQIRNIPPHLQWE - UNI18275 - VLDGLLAEYGTVENVEQV - UNI31699 

- VNTDTETAVVNVTYMTREEAKL - UNI31699 - LAIEKLSGHQFEDYSFKISYIPDEEVSSPSPPHRAREQGHGPGSSSQARQIDFPLRILVPTQ

FVGAIIGKEGLTIKNITKQTQSR - UNI25545 - - UNI31699 - RVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKL LAE

EVPLKILAHNGFVGRLIGKEGRNLKKIEHETGTKITISS SLQDLSIYNPERTITVRGTIEACANAEIEIMKKLREAFENDMLAVN QQANLIPGLNLSA

LGIFSTGLSVLPPPAGPRGVPPSPPYHPFA - UNI25625 - THSGYFSSLYPHHHFGPFPHHHS - UNI20539 - YPEQETVSLFIPTQAVGAI

IGKKGAHIKQLARFAGASIK IAPAEGPDVSERMVIITGPPEAQFK AQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKT VNELQNLT

SAEVIVPRDQTPDENEEVIVRIIGHFFASQ TAQRKIREIVQQVKQQEQRYPQGVAPQRSK
Transcript ENSMUST00000100052
Sequence
GGAGGGCAGCGGAGGCGGCGGGAGCGCCGGGTGCCGGGCCGGGGGAGCCGCGGGCTCTCGGGAAGACGCGGATGATGAACAAGCTGTACATTGGGAACCT

GAGCCCCGCCGTCACCGCCGACGACCTCCGGCAGCTCTTCGGGGACAGGAAGCTGCCCCTGGCGGGACAGGTCCTACTCAAGTCCGGCTACGCCTTCGTG

GACTACCCCGACCAGAACTGGGCCATCCGCGCCATCGAGACCCTCTCGG - UNI25729 - - UNI30317 - GTAAAGTGGAATTGCATGGGAAAA

TCATGGAAGTTGACTACTCAGTCTCTAAAAAGCTAAG - UNI13456 - - UNI30317 - GAGCAGAAGAATCCAGATTCGGAACATCCCGCCTCA

CCTGCAGTGGGAG - UNI18275 - GTGTTGGATGGGCTGTTGGCTGAATATGGGACAGTGGAGAACGTGGAGCAAG - UNI31699 - TCAACAC

AGATACAGAAACTGCCGTTGTCAACGTCACCTATATGACAAGAGAAGAGGCAAAGCT - UNI31699 - AGCTATTGAGAAGCTCAGTGGGCATCAGT

TTGAGGACTACTCCTTCAAGATTTCCTACATCCCCGATGAAGAGGTGAGCTCTCCTTCACCCCCTCATCGTGCCCGGGAACAAGGCCACGGCCCCGGGAG

CTCTTCTCAGGCCAGACAGATTGATTTCCCGCTGCGGATCCTGGTCCCCACCCAGTTTGTTGGTGCCATCATCGGAAAGGAGGGCTTGACCATAAAGAAC

ATCACTAAGCAGACCCAGTCCCG - UNI25545 - - UNI31699 - GGTAGACATCCACAGAAAGGAGAACTCTGGGGCTGCAGAGAAGCCTGTCA

CAATCCATGCTACCCCAGAAGGGACATCTGAAGCATGCCGCATGATTCTTGAGATTATGCAAAAAGAAGCTGATGAGACCAAACT GGCTGAGGAGGTTC

CTCTGAAAATCCTGGCCCACAATGGCTTCGTTGGAAGACTGATTGGCAAAGAAGGCAGAAACCTGAAGAAAATAGAACATGAGACAGGGACCAAGATAAC

CATCTCATC CTTGCAGGATTTGAGCATTTATAACCCCGAGAGAACCATCACCGTGAGGGGCACCATTGAAGCCTGTGCCAATGCTGAGATAGAGATTAT

GAAGAAGCTCCGAGAGGCCTTTGAGAACGACATGCTGGCCGTTAAC CAACAAGCCAATCTGATCCCAGGGCTAAACCTCAGTGCACTTGGCATCTTTTC

GACTGGACTGTCTGTGCTTCCTCCACCAGCAGGGCCCCGTGGAGTTCCCCCCAGTCCTCCCTATCACCCCTTTGCT - UNI25625 - ACCCACTCCG

GATACTTCTCCAGTCTGTACCCTCATCACCATTTCGGCCCATTCCCACATCATCACTCC - UNI20539 - TACCCAGAGCAGGAGACTGTAAGTCTC

TTCATCCCAACCCAGGCTGTGGGTGCTATCATCGGGAAGAAGGGGGCACACATCAAACAGCTCGCTCGATTTGCTGGTGCCTCCATCAAG ATTGCTCCA

GCAGAAGGTCCAGATGTCAGTGAGAGGATGGTCATCATCACTGGTCCTCCTGAAGCCCAGTTTAAG GCTCAGGGACGGATCTTTGGGAAACTGAAGGAA

GAAAACTTCTTTAATCCCAAAGAAGAAGTGAAGCTGGAGGCCCACATCCGAGTCCCCTCGTCGACCGCTGGCCGGGTGATTGGCAAGGGCGGGAAAACC 

GTGAACGAGCTGCAGAACTTGACAAGTGCAGAAGTTATCGTGCCTCGTGACCAAACGCCAGACGAGAATGAGGAAGTGATCGTCAGAATTATCGGGCATT

TTTTTGCTAGCCAG ACTGCACAACGCAAGATCAGGGAAATTGTACAGCAGGTGAAGCAGCAGGAGCAGAGATACCCTCAGGGAGTCGCCCCACAGCGCA

GCAAGTGAGGCTCCCACAGCACCAGCAAGCAACCGATGAATGTAGCCCTCCCAACACCTGACAGATGAGACCAAACAGCCAGCAGATCGGGAGCAAACCA

AAGAGCATCCCGAGGAGTGCGCAGTCTGCAGAGCAGCCAGGGCCTGCAGACCTCTACACATCCTGGGATCCAGGAGGGCACAGGGAAGGCCAGGTTGTCC

AGAAACACCGCTTGGCCTGCCCCCAGCTTCCCCTGGCTTCTGCAGGCATAACAGCCATCCACTGCCCATCCAACTCAGATTCTCCTCAGTTCCCAGGACG

CTATCCCTTTCGGTTGAACTAACATAGGTGAACATGCTCAAAGCAAAGCAAAATTCCTAGCCGTTTCTTTGTTGTGGAAAGTTGTCTCTGTACATGTATG

TACATATCAGAAGGGGAAGGATGTTAAGAAATGTGGCCTGTGGGTTACACAGGGTGCCTGCAGCGTTAATATATTTTAGAAATAATATATCAAATAACTC

CACTAACAACAATTTTTACTCAGTGATTAATTTTGTTTTCTTTTTGAAGAGAAAGCAGGCTTTTCTAGACTTCCAAGAATAAAGTATTGGGTGAGGTCCA

CTGGTATAGAAAGGAACTTTGAGCCACCCACACAAAAAATTCACTTGGAGGGAAATCTTGTCAAGGACACTTAATGGCAGTTGTGGGTCACCTGTGTCTG

TCAACAGAAGGGATACCGTCCCTGAGGAGGGGCCCTAGGCCCTGGTCACCTGTTTCTCCCACACACCCATTGCTCAGTTTCACAGGTTTTTAAACTGATG

ATTTTTGGTTTGTTTTGTTTTTGTTTTTTGCATACTGCTATATAGTTCTGTCTCTCTCCTTATCTCCCTCCTAACCTTCCTCTGTCTTCTTTACCCAAAA

TTCTTTTGAGTCCCTTCGTTCTTTTTCTGCTCCCCGTATCTATGCACCCCTCCCCTCCCCCCAGGCAAAGCAGTGCTCTGAATATCATACCACACACAAG

GAACAAATGCGAACCACACAGACCAGCCTCAGCTTACACTCGGTTACTCAAGCGAACAAGAGTCGGCGGTACTTGTCCTAGCATTCGGAAGAGGAAAGCA

GGATCCCAGCAAATAAACCAGCCAGCCAAACAAAGAAAAATCCCACAAAGAAAGAATGGACTCTCTCTCCATCTTGGTATACAAGCCATCAACATTTAGT

GAAATTCTTTCTTTCTTTAAAAATTTAAAGTGCAGGAAAATAGCAATTTATACGAGGTTGTTGGCCCAGGGCGTTAAATTTACAGATTTTTTTTAAATGA

GAAAAACACACAAATAAAAGCTACCTCAGGTGTTTTTTACCTCAGCACCTTGCTCTTGTGTTTCCCTTAGAGATTTTGTAAAACTGATAGTTGGAGCATT

TTTTATTTTTTTAATAAAAATGAGTTGAAAAAAAAAAAAGATGAGCTGCCAGCCCCAAGCAGGCGGCAGCCCAGGTGTGCCGCAGCTCTTCTGTCTTCCG

CTAGCCAAGAGCCTACGTGGCCTTCTTGTGGACAAACCTAAAAATGTTTATTTTTTAAAAAGTGACAAAGAAAAACAGAGAATATTGGAGCCGTCCTGAA

TTTCAATAGGGTACGTGCCGTGAGGGCTTTTGCGCTGAAGGATGACCACATCCTGGTTATGTGAAGAAACCATGACACTACCAGACTGCGATGCCGGTTT

CCTCTACTGCAAGCAGTGTTCTGTG
Translation
MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSG - UNI25729 - - UNI30317 - GKVELHGKIMEVD

YSVSKKLR - UNI13456 - - UNI30317 - RSRRIQIRNIPPHLQWE - UNI18275 - VLDGLLAEYGTVENVEQV - UNI31699 - VN

TDTETAVVNVTYMTREEAKL - UNI31699 - LAIEKLSGHQFEDYSFKISYIPDEEVSSPSPPHRAREQGHGPGSSSQARQIDFPLRILVPTQFVGA

IIGKEGLTIKNITKQTQSR - UNI25545 - - UNI31699 - RVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKL LAEEVPL

KILAHNGFVGRLIGKEGRNLKKIEHETGTKITISS SLQDLSIYNPERTITVRGTIEACANAEIEIMKKLREAFENDMLAVN QQANLIPGLNLSALGIF

STGLSVLPPPAGPRGVPPSPPYHPFA - UNI25625 - THSGYFSSLYPHHHFGPFPHHHS - UNI20539 - YPEQETVSLFIPTQAVGAIIGKK

GAHIKQLARFAGASIK IAPAEGPDVSERMVIITGPPEAQFK AQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKT VNELQNLTSAEV

IVPRDQTPDENEEVIVRIIGHFFASQ TAQRKIREIVQQVKQQEQRYPQGVAPQRSK

For any suggestions or comments, please send an email to unitrap@crg.es