Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033590 (Myo5c)
Chromosomal location
Chr 9: 75079821 - 75153258 (+)
Description
myosin VC Gene [Source:MGI Symbol;Acc:MGI:2442485]
RefSeq_dna
NM_001081322 
RefSeq_peptide
NP_001074791.1 
UniGene
Mm.41339 
MGI
MGI:2442485 
Uniprot/SPTREMBL
Q6P6F3 Q8BWY8 Q8BZT8 Q99KW2 
Human Ortholog
ENSG00000128833 (MYO5C)
Omim not available
UniTrap UNI30171
Vector Insertion
Chr 9: 75079983 - 75089451
Public Clones D094A11 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18114
Vector Insertion
Chr 9: 75151736 - 75153259
Public Clones not available
Private Clones OST429905 (lexicon) OST393377 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113474
Sequence
AAGAGAGCTGAGCTGTACCT TCAGTACAACAGGGTTTGGATCCCAGATCCTGAGGAAGTTTGGAAGTCGGCTGAAATCGCAAAGGACTACAGAGCGGGT

GACCGAGTCCTCAGACTTCTGCTGGAGGATGGCATG GAGCTGGAATACCCTGTTGACCCAGGGTCACTGCCTCCGCTTCGGAACCCTGACATCCTGGTG

GGTGAGAATGACCTCACAGCCCTCAGCTACCTCCATGAGCCCGCAGTGCTGCATAATCTCAGAATCCGCTTCGCAGAGTCCAAACTCATCTACACCTACA

GTG GAATCATTTTGGTGGCCATGAATCCTTACAAACAGCTACCAATATACGGGGATGCCATCATCCACGCCTACAGCGGACAGAACATGGGTGACATGG

ACCCACACATCTTTGCGGTTGCAGAGGAGGCCTACAAGCAGATGGCCAG GAACAATAGAAATCAGTCCATAATCGTGAGTGGAGAATCAGGAGCCGGGA

AGACTGTCTCTGCACGCTATGCCATGAGGTACTTCGCTACCGTCAGCAAATCGAGCAGCAATGCCCATGTGGAGGACAAAGTCTTGGCATCCAATCCCAT

AACTGAG GCTGTTGGAAATGCCAAGACCACCCGCAATGACAACAGCAGTCGGTTTGGGAAATACACAGAGATCAGCTTTGATGAGAGAAACCAGATCAT

TGGCGCCAATATGAGAACTTACCTCCTGGAGAAGTCCAGAGTTGTCTTTCAG TCAGAAAATGAACGGAATTACCACATCTTCTACCAGCTTTGTGCATC

CGCACAGCAGTCAGAATTTAAACACCTTAAACTGG GGAGTGCGGAAGAGTTCAACTACACAAGAATGGGAGGTAACACTGTCATTGAAGGTGTCAATGA

CAGAGCTGACATGGTGGAGACCCAGAAGACCTTCACACTACTGG GATTCAAGAAAGATTTTCAAATGGATGTTTTTAAGATCCTAGCTGCCATCCTGCA

CCTGGGCAATGTGCAGGTCACCACGGTGGGCAACGAGAGGTCTTCAGTCAGT GAGGATGACAGTCACCTGAAGGTGTTCTGTGAGCTCTTGGGCCTGGA

GACCAGCAAAGTGGCTCAGTGGCTGTGCAACAGAAAAATTGTGACCTCCTCGGAAACTGTGGTAAAGCCCATGACCAGGCCTCAGGCCATCAACGCCAGG

GATGCGCTGGCCAAAAAGATCTACGCTCACCTGTTCGACTTCATTGTCGAGCAAATCAACCAGGCGTTGCACTTCTCAGGCAAGCAGCACACTTTTATTG

GTGTTTTGGACATTTATGG TTTTGAGACCTTTGATGTAAACAGCTTTGAACAGTTCTGCATCAATTACGCTAATGAAAAACTACAGCAGCAGTTTAACC

TG CACGTCTTTAAACTTGAGCAAGAGGAATACATGAAAGAGGACATCCCCTGGACTCTGATAGACTTCTATGACAACCAGCCTGTTATTGACCTGATCG

AGGCAAAAATGGGCATTTTGGAGTTGCTGGATGAAGAATGCTTG TTGCCTCATGGCACCGATGAAAACTGGCTTCAAAAGCTGTATAACAATTTTGTCA

ACAAGAACTCGTTATTCGAGAAGCCTAGAATGTCAAACTCATCCTTCATCATCCAACATTTTGCTGACAAG GTGGAGTACCAATGTGAAGGGTTCCTGG

AGAAGAACAGAGACACTGTCTATGACATGCTGGTGGAGATCCTCAGAGCAAGCAAG TTTCATCTCTGTGCCGCCTTTTTTCAAGAAAGCCCTGTTCCGT

CTTCTCCCTTTGGGGCGATGATCACAGTTAAATCTGCAAAGCAGGTCATCAAGCCGAACACCAAGCACTTCCGGACCACTGTTGGGAACAAG TTCCGCA

GCTCTCTGTACTTGCTCATGGAAACCCTCAATGCCACCACACCCCACTACGTCCGTTGCATCAAGCCAAATGATGAGAAAATGCCCTTTGA GTTTGACT

CCAAGCGGATTGTCCAGCAGCTGCGAGCCTGTGGCGTTTTAGAAACGATTCGCATCAGTGCCCAGAGCTACCCTTCCAG GTGGACATACCTCGAGTTCT

ATAGTCGCTATGGCATCCTCATGACCCAGCAGGAGCTGTCCCTCAGTGATAAGAAGGAGGTGTGCAAGGTGGTTCTGCACAGGCTCATCCAG GATTCTA

ACCAGTACCAGTTTGGTAGAACCAAAATTTTCTTCAGAGCAGGACAAGTGGCTTACTTAGAGAAACTCCGCCTGGATAAACTGAGACAGGATTGTATTAT

GATCCAGAAACACGTGCGAGGCTGGCTGCAGAGGAGGAAGTTCCTCAGGGAGAGACAGGCTGCCCTGACAATCCAACGGTACTTCCGGGGTCAGCAGACA

GTGAG GAAGGCCATCACTGCCACTGCTTTGAAGGAGGCCTGGGCGGCCATCATCCTCCAGAAGTATTGCCGAGGCTACCTGGTCCGTAACCTGTACCAG

CTGATCCGTGTGGCCACCATCACCATCCAGGCACACACCAGGGGCTTCCTAGCCAGGAGGCGGTACCGGAAG TTGTTGCAGGAGCACAAGGCAGTGATC

CTGCAGAAGTATGCGAGGGCCTGGCTGGCCCGGCGCAGATTCCAGAACATCCGCAGGTTCGTGCTCAACATTCAGCTGACTTACAGGGTCCAGCGCTTGC

AGAAGAAGCTGGAGGATCAG AACAGAGAGAACCACGGGCTGGTGGAGAAGCTGACCAGCCTGGCCGCTCTGCGGGTTGGCGATCTGGAAAAGGTTCAGA

AGCTGGAAGCAGAGCTGGAAAAGGCAGCTACCCACCGGCACAGCTATGAAGAGAAGGGCCGCAGATACAGGGACACAGTGGAGGAG AGGTTGTCAAAGC

TGCAGAAGCACAATGCAGAGCTGGAGCTGCAGAGAGAGCGAGCAGAGCAGATGCTGCAAGAGAAGTCTGAGGAGCTAAAAG AAAAAATGGACAAGCTCA

CCAGGCAGCTGTTTGATGATGTGCAGAAAGAAGAACAGCAAAGACT AGTTCTTGAAAAAGGTTTTGAGCTGAAAACACAAGCCTATGAGAAACAGATAG

AGTCTCTGAGAGAAGAGATTAAAGCCCTCAAGGACGAGAGGTCGCAACTGCATCACCAGCTGGAGGAGGGACAGGTCACCTCTGACCGCCTGAAGGGGGA

GGTGGCCCGCCTAAGCAAGCAGGCAAAG ACCATCTCTGAGTTTGAGAAGGAGATAGAGCTGCTGCAAGCCCAGAAGATAGATGTGGAAAAGCACGTGCA

GTCACAGAAACGGGAGATGAGAG AACGGATGTCAGAGGTCACCAAGCAGCTTTTGGAGAGCTATGACATCGAAGATGTTAGAAGCAG GCTCTCTGTGG

AAGATCTGGAACATTTAAATGAAGATGGAGAACTTTGGTTTGCCTACGAAGGACTAAAGAAAGCAACTCG AGTTCTGGAGAGCCATTTCCAGTCTCAGA

AGGATTGCTATGAAAAAGAGATTGAAGGTCTGAACTTCAAAGTCGTGCACCTGAGCCAAGAGATCAACCACCTGCAGAAGCTGTTCAGAGAAGAGACAGA

CATCAACGAAAGTATCCGGCATGAAGTCACCAGGCTGACATCAGAAAACATG ATGATCCCAGACTTTAAGCAGCAGATTTCAGAGCTGGAGAGGCAGAA

GCAGGATCTTGAATCCCGCCTGAAGGAGCAGGCTGAGAAGATAGAAG GAAAGCTGGAAGAGCCGTTCAGCCACCTGAACCGAATCCGAGAAGAGGAGAG

AATGCAGGGCAG GGCCGTGGAAGCACAGAGTGAGATGCATCCAGAAGGGAAGGAGAGGCTGGTGGGTGCGATCCACGAACCGCATGAAGCCATCAAGTT

CCCAAAGAAGCAACCAGAAGCTGAGGAGGAAGTCGAGAGTATTCTCCAACAAGAAGCGTCCCGGCTCTCTTTGGAAAAGAGG GATCTCGAGGAAGAGTT

AGACATGAAGGACAGAATGATTAGAAGGCTACAAGATCAAGTCAAGACTCTGACCAAGACGACTGAGAAAG CCAACCATGTGCACCTGCCCTCGGGATC

CAGGGAGTACCTGGGGATGCTGGAATACAAGAAAGAAGATGAGGGGAAGCTCATTCAAAACCTCATTCTTG ACCTGAAGCCCCGAGGTGTGGTGGTGAA

CATGATCCCAGGGCTGCCAGCTCACATCCTGTTCATGTGCGTGCGATACGCGGACTCCCTAAACGACGCCAACATGCTCAAATCCCTCATGAACAGTGCT

ATTAACGGCATCAAGCATGTGGTTAAG GAACATTTTGAAGATTTGGAGATGCTGTCCTTCTGGCTTTCCAACACTTGCCATTTTCTTAACTGCCTGAAG

CAGTACAGCGGAGAAGAG GAATTCATGAAGTATAACAGCCCACAGCAGAATAAGAACTGCTTGAACAATTTTGATCTTACAGAATACAGACAGATTCTC

AGTGATGTGGCCATACGGATTTATCATCAGTTCATCATTGTGATGGAAAACAACCTCCAGCCGATAATAG TGCCAGGCATGCTGGAGTATGAGAGCCTG

CAGGGCATTTCCGGCCTGAAGCCCACTGGTTTCCGGAAGCGCTCATCCAGCATCGACGACACAGATGCCTACACCATGACGTCCATCCTGCAGCAGCTGA

GCTACTTCTACAGCACCATGTGTCAGAACGGCCTGGACCCCGAGATTGTGAGGCAGGCGGTCAAGCAGTTGTTCTACCTGGTCGGGGCGGTGACCCTCAA

CAGCCTCCTCCTGCGCAAGGACATGTGCTCCTGCAGGAAAGGCATGCAGATCAG GTGCAACATCAGCTTCTTGGAAGAATGGCTAAAAGATAAGAATGT

GCAGAGTAGCTTAGCCAAGGAGACACTGGAGCCCCTCTCTCAGGCAGCCTGGTTGCTGCAGGTGAAGAAGACCACAGACAGTGATGCCAAGGAGATCGCC

CAGTGTTGCACTTCCCTGTCTGCTGTGCAG ATCATAAAGATCCTTAATTCATACACACCTATAGACGACTTCGAGAAAAGAGTCAATCCATCCTTCGTC

CGCAAAGTACAG - UNI18114 - GCTCTTCTGAATAACCGGGGCGACTCGGCACAGCTGATGCTGGATACCAAATATCTTTTTCAAGTCACATTTCC

TTTCACCGCCTCACCACACGCCCTGGAGATGACCCAGATCCCCAGCAGCTTCAAGCTCGGCTTTCTCCGGAGACTGTAGCCAGAGAGAAGATGGACGTGA

GTTCCCTGGAGTCCTGAGTGCAGGTGCCACGGAGGGATGCAGTTATTCACCAGAGCATTGTGATGGGTTGCAATTTGAGGAAAAACCACGCCCCACCTGT

CTCCCATGATGCTTTGCAACCGGCTGGGCTGGGAAAGGCTCTTGCTTCTGATCTCAAGTGGCTATTGTTGCAATTCCTGAAGGCTCGGTTTTGTTCCTGG

TACCTTTGTTTTGTGGCAGGGACCTCCCCTCACCCACATATATACAGGAGTAAAATCTAGAGGCACCATGACTCCCCCGATTTCTAGGGTTCCCGTGAAG

TGCAGAGACATGTATGAAGCCACAGTTGAGTTCCATGCCTACACCTTCTAGGAAAGAATTCCACGTGGCCACTGGAACAAAGTCTTTTTGCCCCATCCCT

GTTGACAGGAAGGGCTCGTTAGCTCCTCCTACTAAAGACGACTGGATTAGAAAACTACTCCCTTTAGAAACTCTAAGAGGGTATTCAGTCTAAGAGCAGG

TCATGGTAACCCATAACTAGAATCCCAGCACTCAGGAGGATGAGACCAGAGATTTATCTCGAGTTCAGTGTCAGCCTTGACTACAGAGTGAGAACCCATC

TCAGAGATAGATAGATAGATAGATAGATAGATAGATAGATAGATAGATAGATAGATAGATAAATAGATAAATATAAATAAATAAGAGCATTTTATTTATC

TATTTTATGCCATTTATCTTTTTTCTGAAATTTTTAAAACTTGTTATTAGCCAACATAGTTATTATAATCTTTCATTTAATTTTTAAATACAGCTATTTC

TTTTAAAACTACATTTATCTCTGGGGTCAGAACTCAGTGGTAGAGCAGTTGGCCCTGGGTTTGGCCCCAGCACCACACATGCACACGTGTGCAACTTAAG

TTTTTTTTTCCTCTTTCTAATCAGTGTTCTAATATGCTTTTTAAATTTTTTTTCACGAAAAAAAAAAAAAAAAACAACAACAGAAGATATGGGGAAGCTC

TTCCTTTTGAGAAATCCACTTTTCCCAGGTTTTGTGAGAACTAGTTATTCCTTCCCTCAAACTGTTTTCCTTCCCTTCAGAGAACTGAGTCCTCTGATGA

GCACTCCTGACCCAGAGCTGAGACCCATCACTCTGTGCACCCCTAGCAACCTGACCACCCTCCAGTCTGATGGTCACAGGCAGTAGCTGTGACACCACAG

AATGGTCCTCTCTGGGGCGACCGGTTGATTGTTCAGTACCACCTACTAAACGTGTAGTCATCCTACTGACATGATGGCTTTCCAAACTGTTCCCAAGTGC

TGAAAATAGAACTTTATAATACTTAAATAAAATAAATTATTGAGCAAA
Translation
KRAELYL LQYNRVWIPDPEEVWKSAEIAKDYRAGDRVLRLLLEDGM ELEYPVDPGSLPPLRNPDILVGENDLTALSYLHEPAVLHNLRIRFAESKLIY

TYSG GIILVAMNPYKQLPIYGDAIIHAYSGQNMGDMDPHIFAVAEEAYKQMAR RNNRNQSIIVSGESGAGKTVSARYAMRYFATVSKSSSNAHVEDKV

LASNPITE AVGNAKTTRNDNSSRFGKYTEISFDERNQIIGANMRTYLLEKSRVVFQ SENERNYHIFYQLCASAQQSEFKHLKLG GSAEEFNYTRMGG

NTVIEGVNDRADMVETQKTFTLLG GFKKDFQMDVFKILAAILHLGNVQVTTVGNERSSVS EDDSHLKVFCELLGLETSKVAQWLCNRKIVTSSETVVK

PMTRPQAINARDALAKKIYAHLFDFIVEQINQALHFSGKQHTFIGVLDIYG GFETFDVNSFEQFCINYANEKLQQQFNL HVFKLEQEEYMKEDIPWTL

IDFYDNQPVIDLIEAKMGILELLDEECL LPHGTDENWLQKLYNNFVNKNSLFEKPRMSNSSFIIQHFADK VEYQCEGFLEKNRDTVYDMLVEILRASK

 FHLCAAFFQESPVPSSPFGAMITVKSAKQVIKPNTKHFRTTVGNK FRSSLYLLMETLNATTPHYVRCIKPNDEKMPFE EFDSKRIVQQLRACGVLET

IRISAQSYPSR RWTYLEFYSRYGILMTQQELSLSDKKEVCKVVLHRLIQ DSNQYQFGRTKIFFRAGQVAYLEKLRLDKLRQDCIMIQKHVRGWLQRRK

FLRERQAALTIQRYFRGQQTVR RKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRK LLQEHKAVILQKYARAWLAR

RRFQNIRRFVLNIQLTYRVQRLQKKLEDQ NRENHGLVEKLTSLAALRVGDLEKVQKLEAELEKAATHRHSYEEKGRRYRDTVEE RLSKLQKHNAELEL

QRERAEQMLQEKSEEL                  - UNI18114 - 
Transcript ENSMUST00000036555
Sequence
AACCCCAGTCCGGGCGCCAGAGCCCTCGGGGGAAGGGAGCCGTGGCACTCGGGAAAACTTCTGCACAAGATGGCCAGGCGCTGAGTGCCTGGGCGCGCAC

AGTCCCCTGCAGCAACAGCAGCAGAGAGGAGGTCCATGGCGGTGGCCGAGCTCTACGCGCAG - UNI30171 - TACAACAGGGTTTGGATCCCAGAT

CCTGAGGAAGTTTGGAAGTCGGCTGAAATCGCAAAGGACTACAGAGCGGGTGACCGAGTCCTCAGACTTCTGCTGGAGGATGGCATG GAGCTGGAATAC

CCTGTTGACCCAGGGTCACTGCCTCCGCTTCGGAACCCTGACATCCTGGTGGGTGAGAATGACCTCACAGCCCTCAGCTACCTCCATGAGCCCGCAGTGC

TGCATAATCTCAGAATCCGCTTCGCAGAGTCCAAACTCATCTACACCTACAGTG GAATCATTTTGGTGGCCATGAATCCTTACAAACAGCTACCAATAT

ACGGGGATGCCATCATCCACGCCTACAGCGGACAGAACATGGGTGACATGGACCCACACATCTTTGCGGTTGCAGAGGAGGCCTACAAGCAGATGGCCAG

 GAACAATAGAAATCAGTCCATAATCGTGAGTGGAGAATCAGGAGCCGGGAAGACTGTCTCTGCACGCTATGCCATGAGGTACTTCGCTACCGTCAGCAA

ATCGAGCAGCAATGCCCATGTGGAGGACAAAGTCTTGGCATCCAATCCCATAACTGAG GCTGTTGGAAATGCCAAGACCACCCGCAATGACAACAGCAG

TCGGTTTGGGAAATACACAGAGATCAGCTTTGATGAGAGAAACCAGATCATTGGCGCCAATATGAGAACTTACCTCCTGGAGAAGTCCAGAGTTGTCTTT

CAG TCAGAAAATGAACGGAATTACCACATCTTCTACCAGCTTTGTGCATCCGCACAGCAGTCAGAATTTAAACACCTTAAACTGG GGAGTGCGGAAGA

GTTCAACTACACAAGAATGGGAGGTAACACTGTCATTGAAGGTGTCAATGACAGAGCTGACATGGTGGAGACCCAGAAGACCTTCACACTACTGG GATT

CAAGAAAGATTTTCAAATGGATGTTTTTAAGATCCTAGCTGCCATCCTGCACCTGGGCAATGTGCAGGTCACCACGGTGGGCAACGAGAGGTCTTCAGTC

AGT GAGGATGACAGTCACCTGAAGGTGTTCTGTGAGCTCTTGGGCCTGGAGACCAGCAAAGTGGCTCAGTGGCTGTGCAACAGAAAAATTGTGACCTCC

TCGGAAACTGTGGTAAAGCCCATGACCAGGCCTCAGGCCATCAACGCCAGGGATGCGCTGGCCAAAAAGATCTACGCTCACCTGTTCGACTTCATTGTCG

AGCAAATCAACCAGGCGTTGCACTTCTCAGGCAAGCAGCACACTTTTATTGGTGTTTTGGACATTTATGG TTTTGAGACCTTTGATGTAAACAGCTTTG

AACAGTTCTGCATCAATTACGCTAATGAAAAACTACAGCAGCAGTTTAACCTG CACGTCTTTAAACTTGAGCAAGAGGAATACATGAAAGAGGACATCC

CCTGGACTCTGATAGACTTCTATGACAACCAGCCTGTTATTGACCTGATCGAGGCAAAAATGGGCATTTTGGAGTTGCTGGATGAAGAATGCTTG TTGC

CTCATGGCACCGATGAAAACTGGCTTCAAAAGCTGTATAACAATTTTGTCAACAAGAACTCGTTATTCGAGAAGCCTAGAATGTCAAACTCATCCTTCAT

CATCCAACATTTTGCTGACAAG GTGGAGTACCAATGTGAAGGGTTCCTGGAGAAGAACAGAGACACTGTCTATGACATGCTGGTGGAGATCCTCAGAGC

AAGCAAG TTTCATCTCTGTGCCGCCTTTTTTCAAGAAAGCCCTGTTCCGTCTTCTCCCTTTGGGGCGATGATCACAGTTAAATCTGCAAAGCAGGTCAT

CAAGCCGAACACCAAGCACTTCCGGACCACTGTTGGGAACAAG TTCCGCAGCTCTCTGTACTTGCTCATGGAAACCCTCAATGCCACCACACCCCACTA

CGTCCGTTGCATCAAGCCAAATGATGAGAAAATGCCCTTTGA GTTTGACTCCAAGCGGATTGTCCAGCAGCTGCGAGCCTGTGGCGTTTTAGAAACGAT

TCGCATCAGTGCCCAGAGCTACCCTTCCAG GTGGACATACCTCGAGTTCTATAGTCGCTATGGCATCCTCATGACCCAGCAGGAGCTGTCCCTCAGTGA

TAAGAAGGAGGTGTGCAAGGTGGTTCTGCACAGGCTCATCCAG GATTCTAACCAGTACCAGTTTGGTAGAACCAAAATTTTCTTCAGAGCAGGACAAGT

GGCTTACTTAGAGAAACTCCGCCTGGATAAACTGAGACAGGATTGTATTATGATCCAGAAACACGTGCGAGGCTGGCTGCAGAGGAGGAAGTTCCTCAGG

GAGAGACAGGCTGCCCTGACAATCCAACGGTACTTCCGGGGTCAGCAGACAGTGAG GAAGGCCATCACTGCCACTGCTTTGAAGGAGGCCTGGGCGGCC

ATCATCCTCCAGAAGTATTGCCGAGGCTACCTGGTCCGTAACCTGTACCAGCTGATCCGTGTGGCCACCATCACCATCCAGGCACACACCAGGGGCTTCC

TAGCCAGGAGGCGGTACCGGAAG TTGTTGCAGGAGCACAAGGCAGTGATCCTGCAGAAGTATGCGAGGGCCTGGCTGGCCCGGCGCAGATTCCAGAACA

TCCGCAGGTTCGTGCTCAACATTCAGCTGACTTACAGGGTCCAGCGCTTGCAGAAGAAGCTGGAGGATCAG AACAGAGAGAACCACGGGCTGGTGGAGA

AGCTGACCAGCCTGGCCGCTCTGCGGGTTGGCGATCTGGAAAAGGTTCAGAAGCTGGAAGCAGAGCTGGAAAAGGCAGCTACCCACCGGCACAGCTATGA

AGAGAAGGGCCGCAGATACAGGGACACAGTGGAGGAG AGGTTGTCAAAGCTGCAGAAGCACAATGCAGAGCTGGAGCTGCAGAGAGAGCGAGCAGAGCA

GATGCTGCAAGAGAAGTCTGAGGAGCTAAAAG AAAAAATGGACAAGCTCACCAGGCAGCTGTTTGATGATGTGCAGAAAGAAGAACAGCAAAGACT AG

TTCTTGAAAAAGGTTTTGAGCTGAAAACACAAGCCTATGAGAAACAGATAGAGTCTCTGAGAGAAGAGATTAAAGCCCTCAAGGACGAGAGGTCGCAACT

GCATCACCAGCTGGAGGAGGGACAGGTCACCTCTGACCGCCTGAAGGGGGAGGTGGCCCGCCTAAGCAAGCAGGCAAAG ACCATCTCTGAGTTTGAGAA

GGAGATAGAGCTGCTGCAAGCCCAGAAGATAGATGTGGAAAAGCACGTGCAGTCACAGAAACGGGAGATGAGAG AACGGATGTCAGAGGTCACCAAGCA

GCTTTTGGAGAGCTATGACATCGAAGATGTTAGAAGCAG GCTCTCTGTGGAAGATCTGGAACATTTAAATGAAGATGGAGAACTTTGGTTTGCCTACGA

AGGACTAAAGAAAGCAACTCG AGTTCTGGAGAGCCATTTCCAGTCTCAGAAGGATTGCTATGAAAAAGAGATTGAAGGTCTGAACTTCAAAGTCGTGCA

CCTGAGCCAAGAGATCAACCACCTGCAGAAGCTGTTCAGAGAAGAGACAGACATCAACGAAAGTATCCGGCATGAAGTCACCAGGCTGACATCAGAAAAC

ATG ATGATCCCAGACTTTAAGCAGCAGATTTCAGAGCTGGAGAGGCAGAAGCAGGATCTTGAATCCCGCCTGAAGGAGCAGGCTGAGAAGATAGAAG G

AAAGCTGGAAGAGCCGTTCAGCCACCTGAACCGAATCCGAGAAGAGGAGAGAATGCAGGGCAG GGCCGTGGAAGCACAGAGTGAGATGCATCCAGAAGG

GAAGGAGAGGCTGGTGGGTGCGATCCACGAACCGCATGAAGCCATCAAGTTCCCAAAGAAGCAACCAGAAGCTGAGGAGGAAGTCGAGAGTATTCTCCAA

CAAGAAGCGTCCCGGCTCTCTTTGGAAAAGAGG GATCTCGAGGAAGAGTTAGACATGAAGGACAGAATGATTAGAAGGCTACAAGATCAAGTCAAGACT

CTGACCAAGACGACTGAGAAAG CCAACCATGTGCACCTGCCCTCGGGATCCAGGGAGTACCTGGGGATGCTGGAATACAAGAAAGAAGATGAGGGGAAG

CTCATTCAAAACCTCATTCTTG ACCTGAAGCCCCGAGGTGTGGTGGTGAACATGATCCCAGGGCTGCCAGCTCACATCCTGTTCATGTGCGTGCGATAC

GCGGACTCCCTAAACGACGCCAACATGCTCAAATCCCTCATGAACAGTGCTATTAACGGCATCAAGCATGTGGTTAAG GAACATTTTGAAGATTTGGAG

ATGCTGTCCTTCTGGCTTTCCAACACTTGCCATTTTCTTAACTGCCTGAAGCAGTACAGCGGAGAAGAG GAATTCATGAAGTATAACAGCCCACAGCAG

AATAAGAACTGCTTGAACAATTTTGATCTTACAGAATACAGACAGATTCTCAGTGATGTGGCCATACGGATTTATCATCAGTTCATCATTGTGATGGAAA

ACAACCTCCAGCCGATAATAG TGCCAGGCATGCTGGAGTATGAGAGCCTGCAGGGCATTTCCGGCCTGAAGCCCACTGGTTTCCGGAAGCGCTCATCCA

GCATCGACGACACAGATGCCTACACCATGACGTCCATCCTGCAGCAGCTGAGCTACTTCTACAGCACCATGTGTCAGAACGGCCTGGACCCCGAGATTGT

GAGGCAGGCGGTCAAGCAGTTGTTCTACCTGGTCGGGGCGGTGACCCTCAACAGCCTCCTCCTGCGCAAGGACATGTGCTCCTGCAGGAAAGGCATGCAG

ATCAG GTGCAACATCAGCTTCTTGGAAGAATGGCTAAAAGATAAGAATGTGCAGAGTAGCTTAGCCAAGGAGACACTGGAGCCCCTCTCTCAGGCAGCC

TGGTTGCTGCAGGTGAAGAAGACCACAGACAGTGATGCCAAGGAGATCGCCCAGTGTTGCACTTCCCTGTCTGCTGTGCAG ATCATAAAGATCCTTAAT

TCATACACACCTATAGACGACTTCGAGAAAAGAGTCAATCCATCCTTCGTCCGCAAAGTACAG - UNI18114 - GCTCTTCTGAATAACCGGGGCGA

CTCGGCACAGCTGATGCTGGATACCAAATATCTTTTTCAAGTCACATTTCCTTTCACCGCCTCACCACACGCCCTGGAGATGACCCAGATCCCCAGCAGC

TTCAAGCTCGGCTTTCTCCGGAGACTGTAGCCAGAGAGAAGATGGACGTGAGTTCCCTGGAGTCCTGAGTGCAGGTGCCACGGAGGGATGCAGTTATTCA

CCAGAGCATTGTGATGGGTTGCAATTTGAGGAAAAACCACGCCCCACCTGTCTCCCATGATGCTTTGCAACCGGCTGGGCTGGGAAAGGCTCTTGCTTCT

GATCTCAAGTGGCTATTGTTGCAATTCCTGAAGGCTCGGTTTTGTTCCTGGTACCTTTGTTTTGTGGCAGGGACCTCCCCTCACCCACATATATACAGGA

GTAAAATCTAGAGGCACCATGACTCCCCCGATTTCTAGGGTTCCCGTGAAGTGCAGAGACATGTATGAAGCCACAGTTGAGTTCCATGCCTACACCTTCT

AGGAAAGAATTCCACGTGGCCACTGGAACAAAGTCTTTTTGCCCCATCCCTGTTGACAGGAAGGGCTCGTTAGCTCCTCCTACTAAAGACGACTGGATTA

GAAAACTACTCCCTTTAGAAACTCTAAGAGGGTATTCAGTCTAAGAGCAGGTCATGGTAACCCATAACTAGAATCCCAGCACTCAGGAGGATGAGACCAG

AGATTTATCTCGAGTTCAGTGTCAGCCTTGACTACAGAGTGAGAACCCATCTCAGAGATAGATAGATAGATAGATAGATAGATAGATAGATAGATAGATA

GATAGATAGATAAATAGATAAATATAAATAAATAAGAGCATTTTATTTATCTATTTTATGCCATTTATCTTTTTTCTGAAATTTTTAAAACTTGTTATTA

GCCAACATAGTTATTATAATCTTTCATTTAATTTTTAAATACAGCTATTTCTTTTAAAACTACATTTATCTCTGGGGTCAGAACTCAGTGGTAGAGCAGT

TGGCCCTGGGTTTGGCCCCAGCACCACACATGCACACGTGTGCAACTTAAGTTTTTTTTTCCTCTTTCTAATCAGTGTTCTAATATGCTTTTTAAATTTT

TTTTCACGAAAAAAAAAAAAAAAAACAACAACAGAAGATATGGGGAAGCTCTTCCTTTTGAGAAATCCACTTTTCCCAGGTTTTGTGAGAACTAGTTATT

CCTTCCCTCAAACTGTTTTCCTTCCCTTCAGAGAACTGAGTCCTCTGATGAGCACTCCTGACCCAGAGCTGAGACCCATCACTCTGTGCACCCCTAGCAA

CCTGACCACCCTCCAGTCTGATGGTCACAGGCAGTAGCTGTGACACCACAGAATGGTCCTCTCTGGGGCGACCGGTTGATTGTTCAGTACCACCTACTAA

ACGTGTAGTCATCCTACTGACATGATGGCTTTCCAAACTGTTCCCAAGTGCTGAAAATAGAACTTTATAATACTTAAATAAAATAAATTATTGAGCAAA
Translation
MAVAELYAQ - UNI30171 - YNRVWIPDPEEVWKSAEIAKDYRAGDRVLRLLLEDGM ELEYPVDPGSLPPLRNPDILVGENDLTALSYLHEPAVLH

NLRIRFAESKLIYTYSG GIILVAMNPYKQLPIYGDAIIHAYSGQNMGDMDPHIFAVAEEAYKQMAR RNNRNQSIIVSGESGAGKTVSARYAMRYFATV

SKSSSNAHVEDKVLASNPITE AVGNAKTTRNDNSSRFGKYTEISFDERNQIIGANMRTYLLEKSRVVFQ SENERNYHIFYQLCASAQQSEFKHLKLG 

GSAEEFNYTRMGGNTVIEGVNDRADMVETQKTFTLLG GFKKDFQMDVFKILAAILHLGNVQVTTVGNERSSVS EDDSHLKVFCELLGLETSKVAQWLC

NRKIVTSSETVVKPMTRPQAINARDALAKKIYAHLFDFIVEQINQALHFSGKQHTFIGVLDIYG GFETFDVNSFEQFCINYANEKLQQQFNL HVFKLE

QEEYMKEDIPWTLIDFYDNQPVIDLIEAKMGILELLDEECL LPHGTDENWLQKLYNNFVNKNSLFEKPRMSNSSFIIQHFADK VEYQCEGFLEKNRDT

VYDMLVEILRASK FHLCAAFFQESPVPSSPFGAMITVKSAKQVIKPNTKHFRTTVGNK FRSSLYLLMETLNATTPHYVRCIKPNDEKMPFE EFDSKR

IVQQLRACGVLETIRISAQSYPSR RWTYLEFYSRYGILMTQQELSLSDKKEVCKVVLHRLIQ DSNQYQFGRTKIFFRAGQVAYLEKLRLDKLRQDCIM

IQKHVRGWLQRRKFLRERQAALTIQRYFRGQQTVR RKAITATALKEAWAAIILQKYCRGYLVRNLYQLIRVATITIQAHTRGFLARRRYRK LLQEHKA

VILQKYARAWLARRRFQNIRRFVLNIQLTYRVQRLQKKLEDQ NRENHGLVEKLTSLAALRVGDLEKVQKLEAELEKAATHRHSYEEKGRRYRDTVEE R

LSKLQKHNAELELQRERAEQMLQEKSEELKE EKMDKLTRQLFDDVQKEEQQRL LVLEKGFELKTQAYEKQIESLREEIKALKDERSQLHHQLEEGQVT

SDRLKGEVARLSKQAK TISEFEKEIELLQAQKIDVEKHVQSQKREMRE ERMSEVTKQLLESYDIEDVRSR RLSVEDLEHLNEDGELWFAYEGLKKAT

R RVLESHFQSQKDCYEKEIEGLNFKVVHLSQEINHLQKLFREETDINESIRHEVTRLTSENM MIPDFKQQISELERQKQDLESRLKEQAEKIEG GKL

EEPFSHLNRIREEERMQGR RAVEAQSEMHPEGKERLVGAIHEPHEAIKFPKKQPEAEEEVESILQQEASRLSLEKR DLEEELDMKDRMIRRLQDQVKT

LTKTTEKA ANHVHLPSGSREYLGMLEYKKEDEGKLIQNLILD DLKPRGVVVNMIPGLPAHILFMCVRYADSLNDANMLKSLMNSAINGIKHVVK EHF

EDLEMLSFWLSNTCHFLNCLKQYSGEE EFMKYNSPQQNKNCLNNFDLTEYRQILSDVAIRIYHQFIIVMENNLQPIIV VPGMLEYESLQGISGLKPTG

FRKRSSSIDDTDAYTMTSILQQLSYFYSTMCQNGLDPEIVRQAVKQLFYLVGAVTLNSLLLRKDMCSCRKGMQIR RCNISFLEEWLKDKNVQSSLAKET

LEPLSQAAWLLQVKKTTDSDAKEIAQCCTSLSAVQ IIKILNSYTPIDDFEKRVNPSFVRKVQ - UNI18114 - ALLNNRGDSAQLMLDTKYLFQVT

FPFTASPHALEMTQIPSSFKLGFLRRL

For any suggestions or comments, please send an email to unitrap@crg.es