Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033629 (Ptplad1)
Chromosomal location
Chr 9: 64834793 - 64869520 (-)
Description
protein tyrosine phosphatase-like A domain containing 1 Gene [Source:MGI Symbol;Acc:MGI:1889341]
RefSeq_dna
NM_021345 
RefSeq_peptide
NP_067320.2 
UniGene
Mm.308180 Mm.436690 
MGI
MGI:1889341 
Uniprot/SWISSPROT
Q8K2C9 
Human Ortholog
ENSG00000074696 (PTPLAD1)
Omim not available
UniTrap UNI6338
Vector Insertion
Chr 9: 64854442 - 64858280
Public Clones YHC292 (baygenomics)
Private Clones OST54882 (lexicon) OST36569 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI66
Vector Insertion
Chr 9: 64852116 - 64853414
Public Clones GC0328 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000036615
Sequence
CTCACTGCGCAAGCGCGAGCCGCGAGCGTGGGTTATCTCGAGACAGCCGGGCTGCGGGCTGCGGAGCGTGCGGGTCTGAGGCCTGCGTTCTGCTAGCTCC

AGCGGCTCACAGGCCGAGGTAACGAGGCGCAGCAAGCCGAGCCTCCCCGCTCCCCCGGACAGCGTGGGCCATGGAGACTCAAGTGCTGACGCCGCATGTC

TACTGGGCTCAGCGACACCGCGAGCTGTATCTGCGCGTGGAGCTGAGTGACGTGCAG AACCCTGCTATCAGCATCACAGACAATGTGCTGCATTTCAAA

G - UNI6338 - CTCAGGGACACGGTGCCAAAGGAGACAATGTCTATGAATTTCACCTGGAGTTCTTAGACCTTGTGAAGCCAGAG CCGGCGTACAG

GCTGACCCAGAGGCAGGTGAACATCACAGTCCAGAAGAAGGGGAGTCATTGGTGGGAAAGACTCACCAAGCAAGAGAAGCGCCCATTGTTTTTGGCCCCT

GACTTTGATCGCTGGCTGGATGAATCTGATGCGGAAATGGAGCTGAGAGCCAAG - UNI66 - GAGGAAGAACGCCTAAATAAACTCAGACTAGAAAG

GGAAGGCTCCCCTGAAA CTCTTACAAACTTGAAGAAAGGGTACCTGTTCATGTACAACCTTGTGCAGCTCCTGGGGTTCTCCTGGATCTTTGTCAACCT

CACAGTGCGGTTCTTTATTTTAGGAAAAG AGTCCTTCTATGACACGTTCCACAATGTGGCTGACATGATGTATTTCTGCCAGATGCTGGCACTAGTGGA

AACCCTCAATGCTGCGATTGGGGTCACAAGTACCCCGGTGCTACCTGCTCTCATCCAG TTTCTTGGAAGAAATTTTATTCTGTTTCTTGTTTTCGGCAC

CATGGAAGAAATGCAAAACAAAGCTGTGGTTTTCTTTGTGTTTTATTCCTGGAGCGCAATTGAAATCTTCAG GTATCCCTTCTACATGCTCTCCTGCAT

TGACATGGACTGGAAGGTGCTCACGTGGCTCCGTTACACTATGTGGATTCCGTTATATCCCCTGGGATGTTTGTCAGAAG CTGTGGCAGTGATCCAGTC

CATTCCAGTATTCAACGAGTCGGGAAGGTTCAGTTTTACTTTGCCATATCCAGTGAAGATGAAAGTCAGATTTTCCTTCTTCCTTCAAGTTTATCTCGTA

ATGTTATTTTTAG GGTTATATATTAATTTTCGTCACCTTTATAAACAGCGCAGGAGGCGGTATGGACAAAAGAAGAAAAAGCTCCACTAAAGATGAATT

TGGTAGCTTCATTTGAGCAGAGTCTATGATTCCTACTCTTCTACTTCTTGTACTGATATAAGGGTTTGTTTTGTTTTGTTTTTTAAAGTAAGGCTGTCTC

TCTTTCCCAGTAACATTCCTGAGTCTACTGTCCTTATCTTAGTGTTGTACTTGCATGACATGGATATCTGGTATCTGAGGACAAGTTCATTCTTGTGTAT

TTAATAACAAAGGTGGCCCTCTTCATGTCTGCTCCTCCCTACAGGCACTGTCTGTCTTCACAGGGCTTGGTCTTTCTGCTGCCACTTGTGAAAACCGAAA

AAAAACAAGACTACATAGCACCGACTTTTTGAAAATCAGATAAACATGGTTATTGACATTTTTTGAGTCAGAGTAGGGCTGGAGAACACTTCATATTTGA

TGCCTTTTAGCTAAAGACATTCATTACTATAGCACTTCCCAGGCATTGAAGAGGCAGAGTGATTTAGAGAACGAAATCAGAACCTGGGAACACCATGACT

ACTTCATTTCTAGCTAAATCAGAACTGCCTTCAACACTGGAGAAAGGGAGAAGTACTGCGCAACAGAGATTAGAAGTCCAAATGTGAATGGCTGCAGGGG

TCAGAAGGGAACAGAGATGCAGGAGACAGGCAGGATCAGTTGTGGTAATGATGCCTGTGGCAAACACAAACACCTACTTGGGCTGCACACAGTCACACAA

TCAATCTATAATTCTTGGGGTTAGCTCAGTCCATTTACTTGTGTATTTCTGAGTGGTTGGTGAGATTACTTTATTGAACTGTTTTTTTCCTTGTTAGATT

TTTTTTTCTCTTTTTTTGTTTTTTAAGATAGGGTTGTTCTGTGTAGCTTTGGCTCTCCTAGAACTTGCTCTGTAGACCAGGCTGGCCTTGAACACAGAAA

GAGATTCATCTGCCTCTGCCTCCTGAGTGCTGGGATTAAAGGCAAAAGCCACCACAGCCTGTTTTGTTTTGTTTTCGGTTTAAAAACAACAACAAACTGT

GTGCATGCAGAATACAGACCTTGAGGTTGGCTACTGTTCAAGACAGCTTCAGTCTCTCTACCACATTCCATGTAAACCTATGGTGAAGTAACACCAGAAA

AAAGAGCCTGAGAGTGGTCGCTTCCATCTTCCACTCCCCTTGTTCTTGGGGGGAAAGGAAGGAGACTTCTGCTGTTGCAGTGAGCCCAGAGTGGATTGGC

ATTAAACTGGCTGCTTTGACACACCTCATCTCACCCAAGAGTATTTCCCAAGTCTGCAGCTTCCGTCAGCGATTGTTGTGTTACCTTCTGGTGTTCCCTC

ACTGATTGTGGACAAACCTGGCAGTTGAGCTTTGCAGTCAATTATGCCGTATCCCTGTGCAAACTCCCATGTTCTAGTTGCTGTTAGCATCCCCTTTGTT

GCTGTCTGAGAAAGTGAAAGATTGTGTATTTCTATTAAAACATTTACAGTCAAAATCC
Translation
METQVLTPHVYWAQRHRELYLRVELSDVQ NPAISITDNVLHFKA - UNI6338 - AQGHGAKGDNVYEFHLEFLDLVKPE PAYRLTQRQVNITVQK

KGSHWWERLTKQEKRPLFLAPDFDRWLDESDAEMELRAK - UNI66 - EEERLNKLRLEREGSPET TLTNLKKGYLFMYNLVQLLGFSWIFVNLTVR

FFILGKE ESFYDTFHNVADMMYFCQMLALVETLNAAIGVTSTPVLPALIQ FLGRNFILFLVFGTMEEMQNKAVVFFVFYSWSAIEIFR RYPFYMLSC

IDMDWKVLTWLRYTMWIPLYPLGCLSEA AVAVIQSIPVFNESGRFSFTLPYPVKMKVRFSFFLQVYLVMLFLG GLYINFRHLYKQRRRRYGQKKKKLH


For any suggestions or comments, please send an email to unitrap@crg.es