Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033685 (Ucp2)
Chromosomal location
Chr 7: 107641880 - 107648134 (+)
Description
uncoupling protein 2 (mitochondrial, proton carrier) Gene [Source:MGI (curated);Acc:Ucp2-001]
RefSeq_dna
NM_011671 
RefSeq_peptide
NP_035801.3 
UniGene
Mm.171378 
MGI
MGI:109354 
Uniprot/SWISSPROT
P70406 
Uniprot/SPTREMBL
Q549J5 Q8CBU0 Q9R246 
Human Ortholog
ENSG00000175567 (UCP2)
Omim 607447 - BODY MASS INDEX QUANTITATIVE TRAIT LOCUS 4  
UniTrap UNI28195
Vector Insertion
Chr 7: 107641975 - 107642722
Public Clones IST14022F11 (tigm)
Private Clones OST37562 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14303
Vector Insertion
Chr 7: 107642885 - 107645234
Public Clones FHCRC-GT-S20-3G1 (fhcrc) IST12350C4 (tigm) IST14852F10 (tigm) IST12405B7 (tigm)
IST12286D3 (tigm)
Private Clones OST456502 (lexicon) OST452424 (lexicon) OST417030 (lexicon) OST353610 (lexicon)
OST346971 (lexicon) OST313283 (lexicon) OST277044 (lexicon) OST250726 (lexicon)
OST243953 (lexicon) OST223340 (lexicon) OST191909 (lexicon) OST101095 (lexicon)
OST94582 (lexicon) OST39966 (lexicon) OST35773 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33530
Vector Insertion
Chr 7: 107645815 - 107646586
Public Clones IST10170A11 (tigm) IST13132C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 36% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20153
Vector Insertion
Chr 7: 107646782 - 107646856
Public Clones IST10170A11 (tigm)
Private Clones OST371304 (lexicon)
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19763
Vector Insertion
Chr 7: 107646959 - 107647244
Public Clones IST14822G10 (tigm)
Private Clones OST381352 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32057
Vector Insertion
Chr 7: 107647426 - 107647744
Public Clones CMHD-GT_444B11-3 (cmhd) IST12335G9 (tigm) IST14822G10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000032957
Sequence
CCCTCGGTGTCGTCGGGTCGCCAGCTTCCTGGGCAGCCACCACTCTCCCGCCGTCGGACACAGCCTTCTGCACTCCTGTGTTCTCCTGCGGTCCG - UN

I28195 - GACACAATAGTATGAACTTTAAGTGTTTCGTCTCCCAGCCATTTTCTATGGAAAATCGAGGGGATCGGGCCATGGTAGCCACCGGCAGCTT

TGAAGAACGAGACACCTTTAGAGAAGCTTGACCTTGGAGGCCTCAGCCTGAGACCTCAAAGCAGCCTCCAG - UNI14303 - AACTCCGGCAGAGTT

CCTCTGTCTCGTCTTGCCGATTGAAGGTCCCCGTTTCTCCAATTTCTCTCCATCTTCTGGGAGGTAGCAGGAAATCAGAATCATGGTTGGTTTCAAGGCC

ACAGATGTGCCCCCAACAGCCACTGTGAAGTTCCTGGGGGCTGGGACAGCTGCCTGCATTGCAGATCTCATCACTTTCCCTCTGGATACCGCCAAGGTCC

GGCTGCAG ATCCAAGGGGAGAGTCAAGGGCTAGTGCGCACCGCAGCCAGCGCCCAGTACCGTGGCGTTCTGGGTACCATCCTAACCATGGTGCGCACTG

AGGGTCCACGCAGCCTCTACAATGGGCTGGTCGCCGGCCTGCAGCGCCAGATGAGCTTTGCCTCCGTCCGCATTGGCCTCTACGACTCTGTCAAACAGTT

CTACACCAAGGGCTCAGAGC - UNI33530 - ATGCAGGCATCGGGAGCCGCCTCCTGGCAGGTAGCACCACAGGTGCCCTGGCCGTGGCTGTAGCCC

AGCCTACAGATGTGGTAAAGGTCCGCTTCCAGGCTCAGGCCCGGGCTGGTGGTGGTCGGAGATACCAGAGCACTGTCGAAGCCTACAAGACCATTGCACG

AGAGGAAGGGATCCGGGGCCTCTGGAAAG - UNI20153 - GGACTTCTCCCAATGTTGCCCGTAATGCCATTGTCAACTGTGCTGAGCTGGTGACCT

ATGACCTCATCAAAGATACTCTCCTGAAAGCCAACCTCATGACAG - UNI19763 - ATGACCTCCCTTGCCACTTCACTTCTGCCTTCGGGGCCGGC

TTCTGCACCACCGTCATCGCCTCCCCTGTTGATGTGGTCAAGACGAGATACATGAACTCTGCCTTGGGCCAGTACCACAGCGCAGGTCACTGTGCCCTTA

CCATGCTCCGGAAGGAGGGACCCCGCGCCTTCTACAAGGG - UNI32057 - GTTCATGCCTTCCTTTCTCCGCTTGGGATCCTGGAACGTAGTGATG

TTTGTCACCTATGAGCAGCTCAAAAGAGCCCTAATGGCTGCCTACCAATCTCGGGAGGCACCTTTCTGAGCCTCTCCATGCTGACCTGGACCCTGCTTCC

CAGCCCTGCCCTGTCTTTTTCTTCATCCTCTGCCCAGTCCCATTCTCTTCCCATTTCCTGCACCCCGATTTACTTCCCACCTCACCTCCCTGTGCCTCTG

TACTGATGACTCACAGTGAGGAGGCCTGACACCAGACCCTGAGCCCTCAGCCCTTTCTACAGCTAAGCCCACATCTTCATCTTCATCCCCAGCCCAGCCC

AGCCCAGCTCAGCCAGCCTTCACCCATAAAGCAAGCTCAATGTT
Translation
 - UNI28195 -  - UNI14303 - MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQ IQGESQGLVRTAASAQYRGVLGTILTMVR

TEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEH - UNI33530 - HAGIGSRLLAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRY

QSTVEAYKTIAREEGIRGLWKG - UNI20153 - GTSPNVARNAIVNCAELVTYDLIKDTLLKANLMTD - UNI19763 - DDLPCHFTSAFGAGF

CTTVIASPVDVVKTRYMNSALGQYHSAGHCALTMLRKEGPRAFYKG - UNI32057 - GFMPSFLRLGSWNVVMFVTYEQLKRALMAAYQSREAPF

For any suggestions or comments, please send an email to unitrap@crg.es