Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033688 (1300017J02Rik)
Chromosomal location
Chr 9: 103152860 - 103190627 (-)
Description
RIKEN cDNA 1300017J02 gene Gene [Source:MGI Symbol;Acc:MGI:1919025]
RefSeq_dna
NM_027918 
RefSeq_peptide
NP_082194.1 
MGI
MGI:1919025 
Uniprot/SPTREMBL
Q8VC96 Q9DBD0 
Human Ortholog
not available
Omim not available
UniTrap UNI18928
Vector Insertion
Chr 9: 103184998 - 103190510
Public Clones not available
Private Clones OST410854 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035163
Sequence
AGTCAACACTGCCTTCTGGGTAAAGTGCACCTAGGCTGGGGGAGAGCAAGCAGAACGCAGTTCCACAGTTGAAAATGAGGCTGCTCATCTGCGCCCTTCT

ATGCTTGGGGACCCTAG - UNI18928 - GGCTGTGCCTGGCTCTTCCTGAGAAGACCATACGATGGTGCGTTGTGTCAGATCATGAGGCCACTAAGT

GTTCTAGTTTCCGTGACAATATGAAGAAAGTCCTTCCTGCAGGTGGCCCAGCTGTTACCTGTGTAAGGAAAATGTCTCACCCTGAGTGCATCCGGGACAT

CTCG GCCAATAAAGTAGATGCTGTGACTGTTGACGGAGCTTTGGTGGCTGAAGCTGACCTGCCTCACCACAGCCTGAAACCTATCATGGCAGAATACTA

TGGATCAAAAGATG ATCCAAAAACCCATTATTATGTTGTGGCCATGGCAAAGAAGGGAACAGGCTTCCAACTGAACCAGCTCCGGGGCAAGAAGTCCTG

CCATACTGGCCTGGGCTGGTCTGCTGGGTGGTACGTTCCCCTCAGCACCCTGCTTCCTTCTGGCTCTCGGGAAACAG CGGCAGCCACGTTCTTCTCCAG

CAGCTGTGTGCCCTGTGCGGATGGAAAGATGTTCCCCAGCCTGTGCCAACTGTGTGCGGGGAAGGGGACAGACAAGTGTGCCTGCTCCTCCCGGGAACCA

TACTTTGGCTCCTGGGGAGCCTTAAA ATGTCTGCAGGATGGCACGGCGGATGTGAGCTTCGTGAAGCACCTGACAGTGTTTG AGGCCATGCCAACAAA

GGCCGACAGGGACCAATACGAGCTGCTCTGCATGGACAACACCCGCAGGCCAGTGGAGGAATATGAACAGTGCTACCTGGCCCGGGTCCCTTCTCATGTT

GTGGTGGCTCGAAGTGTGGATGGCAAGGAGGACTCCATCCAAGAGCTTCTCAGAGTGGCCCAG GAACATTTTGGAAAAGACAAGTCATCACCCTTCCAG

CTCTTTGGCTCCCCTCACGGGGAGGACCTGCTGTTTACTGATGCTGCTCATGGGCTCCTAAGGGTCCCTCGAAAGATAGACATCAGTCTGTACTTGGGAT

ATGAGTTTCTTTCTGCCTTTCGGAATCTTAAAAGAG GTCTGGAAGACTCCCAGAGGGTGAAGTGGTGTGCAGTGGGCCAGCAGGAGAGGACCAAATGTG

ACCAGTGGAGTGCTGTGAGCGGTGGTGCTTTGGCGTGTGCCACGGAGGAGACCCCTGAGGACTGCATCGCTGCCACCATG AAAGGAGAAGCGGACGCCA

TGAGCCTGGATGGAGGGTTTGCCTACGTCGCAGGCCACTGCGGCCTGGTACCTGTCCTGGCAGAGAACTACT TGTCTACCCACAGCAGTGGGAGGCTGG

GGTCTAAGTGTGTGAACGCACCTTTGGAAG GTTATTATGTTGTGGCTGTGGTTAAGAAATCGGATGTTGGCATCACCTGGAAATCTCTGCAAGGCAAGA

AGTCCTGCCACACGGCCGTTGGCACTTCTGAAGGCTGGAACGTCCCCATGGGTTTAATATACAACCAAACTGGGTCTTGCAAATTTG ATGCATTCTTCA

GTCGCAGCTGTGCCCCAGGGTCTGACCCTGACTCTCCTCTCTGCGCTCTGTGTGTTGGGGGTAACAACCCAGCCCACATGTGTGCTGCCAACAACGCTGA

GGGGTATCACGGCTCCAGCGGAGCTCTCAG GTGTCTGGTTGAGAAGGGGGACGTGGCCTTCATGAAGCACCCTACAGTTCTACAGAACACTGATG GAA

AGAACCCTGAGCCTTGGGCTAAGGGTCTGAAACACGAAGACTTTGAGCTGCTCTGCCTTGATGGCACCAGGAAGCCTGTGACTGAGGCTCAGAGCTGCCA

CCTGGCCAGAGTGCCAAACCGTGCTGTGTTCTCCAGGAAAGATAAGGCTGACTTTGTTCGAAGAATACTCTTCAACCAACAG GAGCTCTTTGGAAGAAA

TGGATTTGAATATATGATGTTCCAGATGTTTGAATCCTCAGCTAAGGACCTGCTTTTCAGTGATGACACAGAATGTTTATCTAACCTTCAGAACAAAACA

ACATATAAAACATACCTAGGACCACAGTATCTTACCTTGATGGATAACTTTAGACAGTGCTTGTCCTCTG AACTGCTGGATGCCTGCACATTTCATAAA

TATTAAACACCATTCAGCTGGGGGGGGCGGTAACCCAGGGGCTGGGGACCCAACTGCTTGCCTCCATGTGGACTTGTGCAGAATGAATAAAAGTATCTTC

CCAG
Translation
MRLLICALLCLGTLG - UNI18928 - GLCLALPEKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDIS ANKVDAVTVDGA

LVAEADLPHHSLKPIMAEYYGSKDD DPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETA AAATFFSSSCVPCADGKM

FPSLCQLCAGKGTDKCACSSREPYFGSWGALK KCLQDGTADVSFVKHLTVFE EAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVD

GKEDSIQELLRVAQ EHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRG GLEDSQRVKWCAVGQQERTKCDQWSA

VSGGALACATEETPEDCIAATM KGEADAMSLDGGFAYVAGHCGLVPVLAENYL LSTHSSGRLGSKCVNAPLEG GYYVVAVVKKSDVGITWKSLQGKK

SCHTAVGTSEGWNVPMGLIYNQTGSCKFD DAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALR RCLVEKGDVAFMKHPTVLQNT

DG GKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQ ELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSN

LQNKTTYKTYLGPQYLTLMDNFRQCLSSE ELLDACTFHKY

For any suggestions or comments, please send an email to unitrap@crg.es