Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033792 (Atp7a)
Chromosomal location
Chr X: 103222615 - 103320256 (+)
Description
ATPase, Cu++ transporting, beta polypeptide Gene [Source:MGI (curated);Acc:Atp7a-002]
RefSeq_dna
NM_009726 
RefSeq_peptide
NP_033856.3 NP_001103227.1 
UniGene
Mm.254297 
MGI
MGI:99400 
Uniprot/SWISSPROT
Q64430 
Uniprot/SPTREMBL
A2AG69 Q3T9Y7 Q3TAY6 A2AG68 
Human Ortholog
ENSG00000215763 (BX276116.7-206)
Omim 304150 - CUTIS LAXA, X-LINKED  309400 - MENKES DISEASE  
UniTrap UNI7354
Vector Insertion
Chr X: 103222719 - 103265108
Public Clones RRU298 (baygenomics) RRS629 (baygenomics) M119F04 (ggtc) D029G02 (ggtc)
P124G07 (ggtc) P068H07 (ggtc) IST11859D8 (tigm) IST13019D1 (tigm)
IST14992D12 (tigm) IST14464A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9083
Vector Insertion
Chr X: 103265108 - 103265247
Public Clones XK122 (baygenomics) XK523 (baygenomics)
Private Clones OST420063 (lexicon) OST376981 (lexicon) OST338203 (lexicon) OST308160 (lexicon)
OST265952 (lexicon) OST220676 (lexicon) OST210051 (lexicon) OST187449 (lexicon)
OST169552 (lexicon) OST168362 (lexicon) OST138372 (lexicon) OST118451 (lexicon)
OST114384 (lexicon) OST77493 (lexicon) OST64192 (lexicon) OST58774 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36719
Vector Insertion
Chr X: 103282154 - 103283676
Public Clones IST10601D3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113557
Sequence
AGACTCTTCTGTGTGTGCGAGCGCGGAGGCTGCGTGCTGGTCAATCGCTGCCGCCCTGCGCCCTGCGGAGCTCCAGAGCTCGAACCCCAGCCCTGGAAAC

CCAG - UNI7354 - - UNI9083 - GAATGTAAAGACATCAAAATGGAGCCAAGTGTGGATGCAAATTCAATTACTATCACTGTTGAGGGAATGAC

ATGTATTTCCTGTGTCCGGACCATTGAACAGCAGATTGGGAAAGTGAATGGTGTCCATCACATTAAA - UNI9083 - GTTTCACTAGAAGAAAAGAG

TGCAACCATTATTTATGACCCTAAACTTCAGACTCCAAAGACCCTCCAAGAAGCTATCGATGACATGGGCTTTGATGCTCTTCTCCACAATGCTAACCCC

CTCCCTGTCTTAACCAATACCGTGTTCCTGACTGTTACTGCTCCACTGACTCTGCCTTGGGACCATATCCAAAGTACATTGCTCAAGACCAAGGGTGTGA

CTGGTGTTAAGATTTCCCCTCAGCAAAGAAGTGCAGTAGTCACCATAATTCCATCTGTGGTGAGTGCCAGTCAGATTGTGGAGCTGGTCCCAGACCTCAG

TTTAGACATGGGAACTCAGGAGAAAAAGTCAGGAGCTTGTGAAGAGCACAGCACGCCTCAGGCAGGGGAAGTCATGCTGAAGATGAAAGTGGAAGGGATG

ACCTGCCATTCATGTACTAGCACCATTGAAGGAAAAGTTGGAAAGCTGCAAGGTGTTCAGCGCATTAAAG TGTCCCTAGACAACCAAGAAGCTACTATT

GTTTTTCAACCTCATCTCATCACAGCAGAGGAAATAAAGAAGCAGATTGAAGCCGTGGGTTTCCCAGCCTTCATAAAAAAGCAGCCGAAGTACCTCAAAT

TGGGAGCCATTGATGTTGAGCGCCTGAAGAACACACCGGTCAAATCTTCAGAAGGATCTCAGCAAAAGAGCCCATCATATCCCAGTGACTCCACAACCAT

GTTCACCATAGAGGGCATGCATTGTAAATCGTGTGTGTCCAATATTGAAAGTGCTTTATCTACACTCCAGTATGTAAGCAGTATAGTAGTTTCTTTAGAG

AATAGGTCAGCCATTGTAAAGTACAATGCAAGCTTAGTCACTCCAGAAATGCTGAGAAAGGCAATAGAGGCCATTTCACCGGGGCAATACAGAGTTAGTA

TTGCAAGTGAAGTTGAAAGTACCGCCAGCTCTCCCTCCAGCTCATCTCTTCAGAAGATGCCTTTGAACATAGTTAGCCAGCCTCTGACCCAAGAAGCTGT

GATAAACATAAATGGCATGACTTGTAATTCTTGTGTGCAGTCTATAGAGGGTGTAATATCAAAAAAGCCAGGTGTAAAATCCATCCACGTGTCCCTCGCA

AACAGCACAGGGACTATTGAATTTGATCCTCTACTAACCTCTCCAGAAACCTTGCGAGAAGCAATTGAAGACATGGGATTTGATGCTGCCTTGCCAG - 

UNI36719 - ACATGAAAGAGCCACTGGTAGTGATAGCTCAGCCCTCACTGGAAACACCTCTTTTGCCCTCAAGTAATGAGCTAGAAAATGTGATGACG

TCAGTTCAGAACAAGTGTTACATACAGGTCTCTGGGATGACCTGTGCTTCTTGTGTAGCAAACATTGAACGCAATTTAAGACGAGAAGAAG GAATATAT

TCTGTACTTGTTGCCCTAATGGCTGGCAAGGCAGAAGTAAGATATAACCCAGCTGTTATCCAACCCCGAGTGATAGCAGAGTTTATTCGAGAGCTTGGAT

TTGGAGCTATGGTGATGGAAAACGCTGGGGAAGGCAACGGCATCTTGGAACTTGTT GTGAGAGGAATGACGTGTGCTTCCTGTGTCCATAAAATTGAAT

CAACACTCACAAAACACAAAGGGATCTTCTACTGCTCTGTGGCCCTGGCAACTAACAAAGCACATATTAAATATGATCCAGAAATTATTGGTCCCAGAGA

TATTATCCATACCATCGGA AGCTTAGGCTTTGAAGCTTCTTTGGTCAAGAAAGATCGATCAGCCAACCACTTAGATCATAAACGAGAAATAAAACA AT

GGAGAGGGTCTTTCCTTGTGAGCCTGTTTTTCTGTATCCCTGTAATGGGACTGATGGTCTATATGATGGTTATGGATCACCACCTTGCAACTCTTCACCA

TAATCAGAACATGAGTAATGAAGAAATGATCAACATGCATTCTGCTATGTTTCTGGAGCGTCAGATCCTGCCAGGACTGTCCATTATGAATTTGTTGTCC

CTTTTATTGTGTCTACCTGTACAG TTTTGTGGCGGCTGGTACTTCTACATTCAGGCTTACAAAGCACTGAAGCATAAGACAGCAAACATGGATGTGCTG

ATTGTGCTGGCAACCACCATCGCATTTGCCTACTCTCTGGTTATTCTTCTGGTTGCAATGTTTGAGAGAGCCAAAGTGAACCCCATTACCTTCTTTGATA

CACCTCCTATGCTGTTTGTGTTTATTGCACTAGGACGATGGCTGGAACATATAGCGAAG GGCAAAACCTCCGAGGCTCTTGCAAAGCTAATTTCATTAC

AAGCAACTGAAGCCACTATTGTAACTCTGAACTCTGAAAATCTCCTCCTGAG TGAAGAACAAGTGGATGTGGAACTTGTACAACGTGGAGATATCATTA

AGGTTGTTCCAGGAGGCAAATTTCCAGTGGATGGCCGTGTTATTGAAGGACATTCTATGGTGGACGAGTCCCTCATCACAG GGGAGGCAATGCCTGTGG

CTAAGAAACCTGGCAGCACGGTGATTGCAGGTTCCATTAACCAGAATGGATCTCTCCTCATCCGAGCAACACATGTGGGAGCAGATACAACCCTTTCTCA

GATCGTCAAACTTGTGGAGGAGGCACAGACATCAAAG GCTCCTATCCAGCAGTTTGCAGACAAACTCAGTGGCTACTTTGTTCCTTTCATCGTCTTGGT

TTCCATTGTTACCCTCTTGGTGTGGATTATAATTGGATTTCAAAATTTTGAAATTGTGGAAACCTACTTTCCC GGCTATAATAGAAGCATCTCCCGAAC

AGAAACCATAATACGCTTTGCTTTCCAAGCCTCTATCACGGTTCTGTGTATCGCATGTCCCTGTTCACTGGGACTAGCCACTCCAACTGCTGTGATGGTG

GGCACAGGAGTAGGTGCTCAGAATGGCATACTTATCAAAGGTGGGGAGCCACTGGAAATGGCTCATAAG GTAAAGGTAGTGGTATTTGATAAGACTGGA

ACCATCACCCATGGAACCCCAGTAGTGAATCAAGTGAAGGTTCTCGTGGAAAGTAACAAGATATCACGCAATAAGATCCTGGCCATTGTGGGGACTGCAG

AAAGTAACAGTGAACATCCTTTAGGAGCAGCTGTAACCAAATATTGCAAAAAG GAGCTGGACACTGAAACCCTGGGTACCTGTACAGATTTCCAGGTTG

TACCAGGCTGTGGTATTAGCTGTAAAGTCACCAATATTGAAGGTTTGCTACATAAGAGTAACTTGAAGATAGAAGAAAATAACATTAAAAATGCATCCCT

GGTTCAAATTGATGCAATTAATGAACAGTCATCAACTTCATCTTCTATGATTATTGATGCTCATCTCTCAA ATGCTGTTAATACTCAGCAGTACAAAGT

CCTCATTGGTAACCGGGAATGGATGATTAGAAATGGTCTTGTCATAAGTAATGATGTAGATGAATCTATGATTGAACATGAAAGAAGAGGTCGGACTGCT

GTCTTGGTGACAATCGATG ATGAGCTGTGTGGCTTGATTGCTATTGCTGATACTGTGAAACCTGAGGCCGAGTTGGCTGTACACATTCTGAAATCTATG

GGTTTAGAAGTAGTTCTGATGACTGGAGACAACAGTAAAACTGCTCGGTCTATTGCTTCTCAG GTTGGCATTACTAAGGTGTTTGCTGAAGTTCTACCT

TCCCACAAAGTTGCTAAGGTGAAGCAGCTCCAAGAGGAGGGCAAACGTGTAGCAATGGTAGGAGATGGAATCAATGACTCCCCAGCTCTGGCAATGGCAA

ACGTTGGAATTGCCATAGGCACAGGCACAGATGTAGCCATTGAAGCAGCTGATGTGGTTTTGATAAGG AATGACCTTCTGGATGTTGTGGCAAGTATTG

ACTTGTCAAGGAAAACAGTCAAGAGGATTCGAATCAATTTTGTCTTTGCTCTAATTTATAATCTGGTTGGAATTCCCATCGCTGCTG GAGTTTTCCTGC

CCATCGGTTTGGTTTTACAACCCTGGATGGGATCCGCAGCAATGGCCGCTTCATCTGTCTCTGTAGTCCTTTCTTCCCTTTTCCTCAAGCT TTACAGGA

AACCTACGTATGACAATTATGAGTTGCATCCCCGGAGCCACACAGGACAGAGGAGTCCTTCAGAAATCAGTGTTCACGTTGGAATAGATGACACCTCAAG

AAATTCTCCAAGGCTGGGTTTGCTGGACCGGATTGTCAACTATAGCAGAGCCTCCATAAATTCACTGCTGTCTGACAAGCGCTCCCTGAACAGCGTTGTT

ACTAGTGAACCTGACAAGCACTCGCTTCTGGTGGGCGACTTCCGGGAAGATGATGACACCACACTGTAAAAAGCCTTGGGGGATGCTGCTAGTTAAAGTT

CACGTGCACTGACACAGCACTTACGTTGATGTAGAAGGATCTTATGTCAATCTCATGCTCTTACGTGCAGGATTCTATCTGAGTTGTATTTGGTAATGGT

GAAAATATCTTTCTCAGGGCAGGAGCTCTGAACCTGGCATTATCTAGAAGAAGTTCCCAGCAGTTTTTGTTTCATTAGCGATACAGAGGGGAGAACAGTA

AGTTTAGAACAAGCTCTATAGTTAGAAGTTGCTAATGTGCTGCTAATATGGCAGATCATTTTTATTTGACC
Translation
 - UNI7354 - - UNI9083 - MEPSVDANSITITVEGMTCISCVRTIEQQIGKVNGVHHIK - UNI9083 - VSLEEKSATIIYDPKLQTPKTL

QEAIDDMGFDALLHNANPLPVLTNTVFLTVTAPLTLPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEE

HSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKV VSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPV

KSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSS

SSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPD - UNI36719 - 

DMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEG GIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGFG

AMVMENAGEGNGILELV VRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIG SLGFEASLVKKDRSANHLDHKREIKQ 

QWRGSFLVSLFFCIPVMGLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQ FCGGWYFYIQAYKALKHKTANMD

VLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAK GKTSEALAKLISLQATEATIVTLNSENLLLS SEEQVDVELVQR

GDIIKVVPGGKFPVDGRVIEGHSMVDESLITG GEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSK APIQQFADKLSGYF

VPFIVLVSIVTLLVWIIIGFQNFEIVETYFP GYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHK VK

VVVFDKTGTITHGTPVVNQVKVLVESNKISRNKILAIVGTAESNSEHPLGAAVTKYCKK ELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKIE

ENNIKNASLVQIDAINEQSSTSSSMIIDAHLSN NAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDD DELCGLIAIADTVKP

EAELAVHILKSMGLEVVLMTGDNSKTARSIASQ VGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVVL

IR NDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAG GVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKL LYRKPTYDNYELHPRSHTGQ

RSPSEISVHVGIDDTSRNSPRLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL
Transcript ENSMUST00000055941
Sequence
CAATCGCTGCCGCCCTGCGCCCTGCGGAGCTCCAGAGCTCGAACCCCAGCCCTGGAAACCCAG - UNI7354 - - UNI9083 - GAATGTAAAGAC

ATCAAAATGGAGCCAAGTGTGGATGCAAATTCAATTACTATCACTGTTGAGGGAATGACATGTATTTCCTGTGTCCGGACCATTGAACAGCAGATTGGGA

AAGTGAATGGTGTCCATCACATTAAA - UNI9083 - GTTTCACTAGAAGAAAAGAGTGCAACCATTATTTATGACCCTAAACTTCAGACTCCAAAGA

CCCTCCAAGAAGCTATCGATGACATGGGCTTTGATGCTCTTCTCCACAATGCTAACCCCCTCCCTGTCTTAACCAATACCGTGTTCCTGACTGTTACTGC

TCCACTGACTCTGCCTTGGGACCATATCCAAAGTACATTGCTCAAGACCAAGGGTGTGACTGGTGTTAAGATTTCCCCTCAGCAAAGAAGTGCAGTAGTC

ACCATAATTCCATCTGTGGTGAGTGCCAGTCAGATTGTGGAGCTGGTCCCAGACCTCAGTTTAGACATGGGAACTCAGGAGAAAAAGTCAGGAGCTTGTG

AAGAGCACAGCACGCCTCAGGCAGGGGAAGTCATGCTGAAGATGAAAGTGGAAGGGATGACCTGCCATTCATGTACTAGCACCATTGAAGGAAAAGTTGG

AAAGCTGCAAGGTGTTCAGCGCATTAAAG TGTCCCTAGACAACCAAGAAGCTACTATTGTTTTTCAACCTCATCTCATCACAGCAGAGGAAATAAAGAA

GCAGATTGAAGCCGTGGGTTTCCCAGCCTTCATAAAAAAGCAGCCGAAGTACCTCAAATTGGGAGCCATTGATGTTGAGCGCCTGAAGAACACACCGGTC

AAATCTTCAGAAGGATCTCAGCAAAAGAGCCCATCATATCCCAGTGACTCCACAACCATGTTCACCATAGAGGGCATGCATTGTAAATCGTGTGTGTCCA

ATATTGAAAGTGCTTTATCTACACTCCAGTATGTAAGCAGTATAGTAGTTTCTTTAGAGAATAGGTCAGCCATTGTAAAGTACAATGCAAGCTTAGTCAC

TCCAGAAATGCTGAGAAAGGCAATAGAGGCCATTTCACCGGGGCAATACAGAGTTAGTATTGCAAGTGAAGTTGAAAGTACCGCCAGCTCTCCCTCCAGC

TCATCTCTTCAGAAGATGCCTTTGAACATAGTTAGCCAGCCTCTGACCCAAGAAGCTGTGATAAACATAAATGGCATGACTTGTAATTCTTGTGTGCAGT

CTATAGAGGGTGTAATATCAAAAAAGCCAGGTGTAAAATCCATCCACGTGTCCCTCGCAAACAGCACAGGGACTATTGAATTTGATCCTCTACTAACCTC

TCCAGAAACCTTGCGAGAAGCAATTGAAGACATGGGATTTGATGCTGCCTTGCCAG - UNI36719 - CAGACATGAAAGAGCCACTGGTAGTGATAG

CTCAGCCCTCACTGGAAACACCTCTTTTGCCCTCAAGTAATGAGCTAGAAAATGTGATGACGTCAGTTCAGAACAAGTGTTACATACAGGTCTCTGGGAT

GACCTGTGCTTCTTGTGTAGCAAACATTGAACGCAATTTAAGACGAGAAGAAG GAATATATTCTGTACTTGTTGCCCTAATGGCTGGCAAGGCAGAAGT

AAGATATAACCCAGCTGTTATCCAACCCCGAGTGATAGCAGAGTTTATTCGAGAGCTTGGATTTGGAGCTATGGTGATGGAAAACGCTGGGGAAGGCAAC

GGCATCTTGGAACTTGTT GTGAGAGGAATGACGTGTGCTTCCTGTGTCCATAAAATTGAATCAACACTCACAAAACACAAAGGGATCTTCTACTGCTCT

GTGGCCCTGGCAACTAACAAAGCACATATTAAATATGATCCAGAAATTATTGGTCCCAGAGATATTATCCATACCATCGGA AGCTTAGGCTTTGAAGCT

TCTTTGGTCAAGAAAGATCGATCAGCCAACCACTTAGATCATAAACGAGAAATAAAACA ATGGAGAGGGTCTTTCCTTGTGAGCCTGTTTTTCTGTATC

CCTGTAATGGGACTGATGGTCTATATGATGGTTATGGATCACCACCTTGCAACTCTTCACCATAATCAGAACATGAGTAATGAAGAAATGATCAACATGC

ATTCTGCTATGTTTCTGGAGCGTCAGATCCTGCCAGGACTGTCCATTATGAATTTGTTGTCCCTTTTATTGTGTCTACCTGTACAG TTTTGTGGCGGCT

GGTACTTCTACATTCAGGCTTACAAAGCACTGAAGCATAAGACAGCAAACATGGATGTGCTGATTGTGCTGGCAACCACCATCGCATTTGCCTACTCTCT

GGTTATTCTTCTGGTTGCAATGTTTGAGAGAGCCAAAGTGAACCCCATTACCTTCTTTGATACACCTCCTATGCTGTTTGTGTTTATTGCACTAGGACGA

TGGCTGGAACATATAGCGAAG GGCAAAACCTCCGAGGCTCTTGCAAAGCTAATTTCATTACAAGCAACTGAAGCCACTATTGTAACTCTGAACTCTGAA

AATCTCCTCCTGAG TGAAGAACAAGTGGATGTGGAACTTGTACAACGTGGAGATATCATTAAGGTTGTTCCAGGAGGCAAATTTCCAGTGGATGGCCGT

GTTATTGAAGGACATTCTATGGTGGACGAGTCCCTCATCACAG GGGAGGCAATGCCTGTGGCTAAGAAACCTGGCAGCACGGTGATTGCAGGTTCCATT

AACCAGAATGGATCTCTCCTCATCCGAGCAACACATGTGGGAGCAGATACAACCCTTTCTCAGATCGTCAAACTTGTGGAGGAGGCACAGACATCAAAG 

GCTCCTATCCAGCAGTTTGCAGACAAACTCAGTGGCTACTTTGTTCCTTTCATCGTCTTGGTTTCCATTGTTACCCTCTTGGTGTGGATTATAATTGGAT

TTCAAAATTTTGAAATTGTGGAAACCTACTTTCCC GGCTATAATAGAAGCATCTCCCGAACAGAAACCATAATACGCTTTGCTTTCCAAGCCTCTATCA

CGGTTCTGTGTATCGCATGTCCCTGTTCACTGGGACTAGCCACTCCAACTGCTGTGATGGTGGGCACAGGAGTAGGTGCTCAGAATGGCATACTTATCAA

AGGTGGGGAGCCACTGGAAATGGCTCATAAG GTAAAGGTAGTGGTATTTGATAAGACTGGAACCATCACCCATGGAACCCCAGTAGTGAATCAAGTGAA

GGTTCTCGTGGAAAGTAACAAGATATCACGCAATAAGATCCTGGCCATTGTGGGGACTGCAGAAAGTAACAGTGAACATCCTTTAGGAGCAGCTGTAACC

AAATATTGCAAAAAG GAGCTGGACACTGAAACCCTGGGTACCTGTACAGATTTCCAGGTTGTACCAGGCTGTGGTATTAGCTGTAAAGTCACCAATATT

GAAGGTTTGCTACATAAGAGTAACTTGAAGATAGAAGAAAATAACATTAAAAATGCATCCCTGGTTCAAATTGATGCAATTAATGAACAGTCATCAACTT

CATCTTCTATGATTATTGATGCTCATCTCTCAA ATGCTGTTAATACTCAGCAGTACAAAGTCCTCATTGGTAACCGGGAATGGATGATTAGAAATGGTC

TTGTCATAAGTAATGATGTAGATGAATCTATGATTGAACATGAAAGAAGAGGTCGGACTGCTGTCTTGGTGACAATCGATG ATGAGCTGTGTGGCTTGA

TTGCTATTGCTGATACTGTGAAACCTGAGGCCGAGTTGGCTGTACACATTCTGAAATCTATGGGTTTAGAAGTAGTTCTGATGACTGGAGACAACAGTAA

AACTGCTCGGTCTATTGCTTCTCAG GTTGGCATTACTAAGGTGTTTGCTGAAGTTCTACCTTCCCACAAAGTTGCTAAGGTGAAGCAGCTCCAAGAGGA

GGGCAAACGTGTAGCAATGGTAGGAGATGGAATCAATGACTCCCCAGCTCTGGCAATGGCAAACGTTGGAATTGCCATAGGCACAGGCACAGATGTAGCC

ATTGAAGCAGCTGATGTGGTTTTGATAAGG AATGACCTTCTGGATGTTGTGGCAAGTATTGACTTGTCAAGGAAAACAGTCAAGAGGATTCGAATCAAT

TTTGTCTTTGCTCTAATTTATAATCTGGTTGGAATTCCCATCGCTGCTG GAGTTTTCCTGCCCATCGGTTTGGTTTTACAACCCTGGATGGGATCCGCA

GCAATGGCCGCTTCATCTGTCTCTGTAGTCCTTTCTTCCCTTTTCCTCAAGCT TTACAGGAAACCTACGTATGACAATTATGAGTTGCATCCCCGGAGC

CACACAGGACAGAGGAGTCCTTCAGAAATCAGTGTTCACGTTGGAATAGATGACACCTCAAGAAATTCTCCAAGGCTGGGTTTGCTGGACCGGATTGTCA

ACTATAGCAGAGCCTCCATAAATTCACTGCTGTCTGACAAGCGCTCCCTGAACAGCGTTGTTACTAGTGAACCTGACAAGCACTCGCTTCTGGTGGGCGA

CTTCCGGGAAGATGATGACACCACACTGTAAAAAGCCTTGGGGGATGCTGCTAGTTAAAGTTCACGTGCACTGACACAGCACTTACGTTGATGTAGAAGG

ATCTTATGTCAATCTCATGCTCTTACGTGCAGGATTCTATCTGAGT
Translation
 - UNI7354 - - UNI9083 - MEPSVDANSITITVEGMTCISCVRTIEQQIGKVNGVHHIK - UNI9083 - VSLEEKSATIIYDPKLQTPKTL

QEAIDDMGFDALLHNANPLPVLTNTVFLTVTAPLTLPWDHIQSTLLKTKGVTGVKISPQQRSAVVTIIPSVVSASQIVELVPDLSLDMGTQEKKSGACEE

HSTPQAGEVMLKMKVEGMTCHSCTSTIEGKVGKLQGVQRIKV VSLDNQEATIVFQPHLITAEEIKKQIEAVGFPAFIKKQPKYLKLGAIDVERLKNTPV

KSSEGSQQKSPSYPSDSTTMFTIEGMHCKSCVSNIESALSTLQYVSSIVVSLENRSAIVKYNASLVTPEMLRKAIEAISPGQYRVSIASEVESTASSPSS

SSLQKMPLNIVSQPLTQEAVININGMTCNSCVQSIEGVISKKPGVKSIHVSLANSTGTIEFDPLLTSPETLREAIEDMGFDAALPA - UNI36719 - 

ADMKEPLVVIAQPSLETPLLPSSNELENVMTSVQNKCYIQVSGMTCASCVANIERNLRREEG GIYSVLVALMAGKAEVRYNPAVIQPRVIAEFIRELGF

GAMVMENAGEGNGILELV VRGMTCASCVHKIESTLTKHKGIFYCSVALATNKAHIKYDPEIIGPRDIIHTIG SLGFEASLVKKDRSANHLDHKREIKQ

 QWRGSFLVSLFFCIPVMGLMVYMMVMDHHLATLHHNQNMSNEEMINMHSAMFLERQILPGLSIMNLLSLLLCLPVQ FCGGWYFYIQAYKALKHKTANM

DVLIVLATTIAFAYSLVILLVAMFERAKVNPITFFDTPPMLFVFIALGRWLEHIAK GKTSEALAKLISLQATEATIVTLNSENLLLS SEEQVDVELVQ

RGDIIKVVPGGKFPVDGRVIEGHSMVDESLITG GEAMPVAKKPGSTVIAGSINQNGSLLIRATHVGADTTLSQIVKLVEEAQTSK APIQQFADKLSGY

FVPFIVLVSIVTLLVWIIIGFQNFEIVETYFP GYNRSISRTETIIRFAFQASITVLCIACPCSLGLATPTAVMVGTGVGAQNGILIKGGEPLEMAHK V

KVVVFDKTGTITHGTPVVNQVKVLVESNKISRNKILAIVGTAESNSEHPLGAAVTKYCKK ELDTETLGTCTDFQVVPGCGISCKVTNIEGLLHKSNLKI

EENNIKNASLVQIDAINEQSSTSSSMIIDAHLSN NAVNTQQYKVLIGNREWMIRNGLVISNDVDESMIEHERRGRTAVLVTIDD DELCGLIAIADTVK

PEAELAVHILKSMGLEVVLMTGDNSKTARSIASQ VGITKVFAEVLPSHKVAKVKQLQEEGKRVAMVGDGINDSPALAMANVGIAIGTGTDVAIEAADVV

LIR NDLLDVVASIDLSRKTVKRIRINFVFALIYNLVGIPIAAG GVFLPIGLVLQPWMGSAAMAASSVSVVLSSLFLKL LYRKPTYDNYELHPRSHTG

QRSPSEISVHVGIDDTSRNSPRLGLLDRIVNYSRASINSLLSDKRSLNSVVTSEPDKHSLLVGDFREDDDTTL

For any suggestions or comments, please send an email to unitrap@crg.es