Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000033826 (Dnahc8)
Chromosomal location
Chr 17: 30761354 - 31012209 (+)
Description
dynein, axonemal, heavy chain 8 Gene [Source:MGI Symbol;Acc:MGI:107714]
RefSeq_dna
NM_013811 
RefSeq_peptide
NP_038839.2 
UniGene
Mm.426017 
MGI
MGI:107714 
Uniprot/SWISSPROT
Q91XQ0 
Uniprot/SPTREMBL
Q3TTQ1 
Human Ortholog
ENSG00000124721 (DNAH8)
Omim not available
UniTrap UNI21347
Vector Insertion
Chr 17: 30761586 - 30772280
Public Clones IST12526H5 (tigm)
Private Clones OST333789 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7869
Vector Insertion
Chr 17: 30773022 - 30780200
Public Clones RRP257 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32823
Vector Insertion
Chr 17: 30790355 - 30793521
Public Clones IST11925F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33307
Vector Insertion
Chr 17: 30827262 - 30830893
Public Clones IST10890F8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29202
Vector Insertion
Chr 17: 30970603 - 30977497
Public Clones not available
Private Clones OST6033 (lexicon) OST227 (lexicon) OST159 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28896
Vector Insertion
Chr 17: 31008379 - 31011786
Public Clones not available
Private Clones OST17012 (lexicon) OST16191 (lexicon)
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035963
Sequence
AGCAGCCACTGTTGGGACCTGCTTTGGCGGTCTAAGGTTCAAGACAGCCTCCCACCAGTTTACAGGCAGGCGAGTGAGTGGTGGATGCGAAGCTTGGAGT

GGCGGATGTAGAAGCTACCACCTGGGAAGTGCCGGGATCCTGTCAGGTGCTGGTGAGACCTGTCAATCCACGTCTGAGTATCTTACTCCACAACCCCGCC

AGCTCCTTTCAAAAAGTGAAAGTTAGAAGTTA - UNI21347 - CTCTTCTGCTGAAGAAAACTACACTGAGAAATGGAGTCTGAGGAAGGCAACGCA

GAGCCACCCCCTCCGAGTGAAGAGGCTCCTCCTCCAGTTGTAGAGGAAGCTCCGCCCCCTCTCCCTCCAGAAGACACTGCCCCTCCCCCTCCCGAGGAGC

AGGCCCCGCCCCCTGAGGGGGATGCTGCCCCGCCCCCCACAGGAGATGCCTTCCAACTCACTGTGGAAGGAGAAGCTCCGCACCCCGAGGATCCCAAGCT

CCTGTCTGAGCAGGGTCCTGCTACTTCCGTGACTGACTATAGGAGTCTGATTCCCTCAGATGAGGAGGTAACACTGCCGGAGGATGAGGAGTCTGGCCAG

GCCAGGGTCCGGGCGAGGCACACCCCTAGGCCTGCACAGTCGGTGCTGTCAGACGGGATTTCGCAGTCTTCCCGGCGGCCCTCTAAGTTCCGCCGAAGTA

TGACTGGCATCCCAAACCTCCAGGAGACCCTCAAAGAGAAACAG GCAAGATTTAGAGAAGCAAGGGAAAACCGGAAAATGAAAATTGGCCCCTCGCATA

AATACATATTTGAAGTTCTAGGAGAAAAGCTTGGGTTGGACTTAGTAACTGTGGAAGAACTAATTTTGGATTGCCCGTCG - UNI7869 - CTGGATC

CGTTCACCAGCTTTTTTGAGAAAGGTGGCTGTAAGACGCTGAAGTTTTTGTACCAGGAAGGAGAAGTGCCCGGTTTTG AATGTGGTCGAACGATTACGG

GAGTCCCCAAAGGGGGGAAAATGATGAGGATTTATGTAGACAACGCAGCTCCGGACAAGCTGAAAGGGCTGTGCTTATTTTTCGTCCGTTGTCGTAATGA

TGTTGCCATAAATTCCAAAACCATTCATGAG GATGTGCTGTTTAGCTTCTTGGATGCATCAAAAGGACTCCTAGAAGGAATCAAGCACATGTTGAAAAG

CATATTTCTCCCAGCCATCCTTGCAACTAGCAACTGGGGAGCTTTAAACCAGTCCAAGCAGGGTGAATCTGAGAAACATATTTTCATAGAAACCATCCAC

AGATATCTTGCATCTTTAGATG ATGCTACCATAAGCATCGAGGGGACAGTGATGTTGAAGAAGGTGGACAATATCGACTTCTCCAAGCTGCACACCTTT

GAAGAGGTCACAGCTGCAGCAAGCAGCTCGGAGATGGTGCATCAGCTGGAGGAGGTGCTGATGGTGTGGTACAAGCAGATCGAGCAG GTCCTCATTGAG

AGTGAGCAGATGAGAAAAGAAGCTGATGATTCCGGTCCCCTCACCGAATTGGAGCATTGGAAGCGTATGTCAGCCAAGTTCAACTTCATCATTGAGCAGA

TTAAAGGGTCCAACTGTAAGGCCGTCATAAATGTGCTAAATGTCGCACACTCCAAGCTGTTAAAG - UNI32823 - AACTGGCGGGATTTGGACGCA

CGAATCACCGACTCCGCTAATGAATCAAAGGATAACGTGCGCTATTTGTACACCCTGGAGAAAGTGTGTCAGCCCCTCTATAACTACGACCTG GTTTCC

ATGGCACACGGGATACAGAACCTGATCAATGCCATCAGAATGATTCACAGTGTGTCGAGGTATTATAATACATCAGAGAGGATGACGTCATTATTCATCA

AG GTGACAAATCAGATGGTAACAGCCTGCAAAGCATACATTACTGACGGCGGAACAAACCATGTGTGGGACCAGGAAACGCCAGCTGTACTAAAAAAAA

TCCAG GATTGCATCTTTCTCTTCAAGGAATACCAGGCATCCTTTCACAAAACAAGGAAGCAGATTTTAGAATCCTCTGGGGAGAAGTCTTTTGAAGTTT

CAGAAATGTATATATTTGGAAAATTCGAAGCCTTCTGTAAGAGACTGGAGAAA ATTACAGAGATGATAACCATTGTGCAGACATACTCAGCCTTGAGCA

ACTCTACAATCGAAGGAATCGATATCCTGGGGATAAAGTTCAAAAACATCTACCAGGGCATTAAGAAGAACCAATATGACATCCTGGATCCACGGAGAAC

AGAATTTGACACAGACTTCACAGAGTTTATGGGGAAAATCAATATTTTAGAG ATTCAAATCCAGGCGTTTATGAACAGCACCTTTGGAAAGATCTTGTC

CTCCCAGCAGGCTCTGCAGCTGCTTCAGAG GTTTCAGAAGCTGAACATCCCCTGCCTTCACCTGGAAATCAATCACACAATTGAACGGATTCTTCAGTG

CTATGTGGCTGAACTTGAATTTACCAAGAAG CTCTATCTTTCTCAGAAAGATGACCCCCCTCTCGCTCGCAACATGCCCCCCATAGCAGGGAAAATTCT

CTGGGTGAGGCAGCTGTTCCGCCGGATAAATGAACCCATCAACTATTTCTTT AAAAACTCAGACATTTTATCAAGCACAGAAGGCAAAGCTGTCATCCG

TCAGTATAATAGGATCGCGTACGTGCTGGTGGAGTTTGAGGTGGCTTACCACACAGCCTGGTTCAAGGAGGTTTCCCAGCTTCAGTATG CTTTGCAAGC

CACGCTGTTTGTGCGACATCCGGAAACGGGGAAGTTGCTGGTTAACTTTGATCCTAAGATTCTGGAAGTTGTGCGGGAAACGAAATGCATGATAAAGATG

AAGCTGGACGTTCCGGAACAAGCAAAGAATTTGCTGAAACTGGAGAGCAAACTGAAGGCAGACAAGCTGTATCTGCAG GGTCTTCTGCAGTATTATGAT

GACCTGTGCCAGGAAGTGCCTTCTGTGTTCGTCAACCTGATGACCCCCAAAATGAAGAAG GTGGAGTCCGTCCTGAGGCAAGGGCTCACAGTGCTGACC

TGGTCCTCGCTAATGCTGGAGAGCTTCTTCAAAGAGGTTGAGTCCGTTTTGGATATGTTCAACCAGCTTTTAAAGAAG GTCAATGACCTGTGTGAGATG

CACATCGACACAGTTCTGAAGGAGATTGCCAAGACATTGCTAATCTCCTTGTCAGATAGCGGCACCACCAAAGTAGAAGACATGCTGACCCTCAACGAG 

ACGTACACCAAAGAGTGTGCTGATATTCTAAACCACAAGAGCAGACATGTGGAGGAAGCCGTGAAAGAGCTGATATTAATATTTGAACAAATCTACGAAG

TTAAATACACCGGAAAAGCAGCCAAATCGGTGAAAG - UNI33307 - AGCAGAGGAAGCGCGTTGTCTTTGGAAGTGAGGCAGAAGAGACCGAAGGC

CTCGACTTTGAATCGACGACGATGGAGGTCGACACCAATGATAAAGAAGATGAATTTAAAAAG GAATGTAAGGAGGTATACGCTTTCTTCTCGCATCAA

TTACTAGACAGCCTACAGAAGGCGACGCGCTTATCTTTGGACACAATGAAAAGGAGAATATTTGTCGGAAG CCAAGGGCGGAGGCGGTCAGAGGACATC

GTTTCCTTCATAAAAACTGAAGTGCACCTTGCAATCCCTAATGTG GTGATGGTTCCCAGCCTGGATGACATTCAGCAAGCCATCAATCGCATGATCCAG

TTGACCCTGGAGGTCAGCAGAGGAGTTGCCCACTGGGGACAGCAGCAGGTCAGGCAGATAAAGTCTTTCCAGAACAATTCTCGTGGCTCCGACCAACCCC

CAGCCTCGGGGAAACCACTGAAAAAGGAAGAGA GGTCTTTTGAAGAAACCATCCCAGCCAGGAAGCTGAAGAACTTCTATCCTGGCGTGGCAGAGCACA

AGGATATCTCCAAGCTGGTGCTCCTCCTGTCCTCCTCTGTGAATTCTCTCCGGAAGGCGGCCACTGAGGCCCTGCAGGACTTTCAGAAGTACAAGACTCT

CTGGATCGAAGACCGCCACGTGAAAGTCAAG GAGTTTTTGGCCAACAACCCTTCCCTGACTGAGATCCGATCAGAAATCCTCCACTATGCCACCCTTGA

GCAAGAGATCAAGGAACTGAAGCCCATTATTGTTGTAGGATCCCTGGAACTGCACACAG AGCCAATGAAGTTAGCCTTATCGATCGAGGCCAAAGCGTG

GAAGATGCTGCTCTGTCGCTACTTAAATGAAGAATATAAGAAGAAAATGTCAGACATGATAACGTTTATCAACGAATACTTGAAAAAGTTGTCCAGACCC

ATCCGAGACTTGGACGATGTCAGATTCGCTATGGAAGCTTTGTCTTGTATTCGAGATAATGAAATTCAAATGGACATGACTTTGGGGCCAATTGAA GAA

GCCTACGGCATTTTGAACAGATTTGAGGTCAAAGTGACCAAGGAAGAGTCCGAAGGCGTTGACACCCTGAGATACTCATTCAACAAATTACAGAGCAAAG

CT GTTTCCGTACAAGGTGAACTTGTGAAAGTGCAGCCCAAATTTAAAAGCAACCTGCTCGAGTCGGTGAAGGTCTTCTGTGAGGACGTTATAAACTTTA

CAGAAGCCTATGAGACG GAAGGACCCATGGTACCAAATATTCCACCCCAAGAGGCTAGCAACAGGCTGCAGATATTCCAG GCCAATTTCGACGATTTA

TGGAGGAAATTTGTCACATATTCATCCGGGGAGCAACTTTTTGGATTACCTGTGACTGACTACGAGGTTTTACACAAAACCAG AAAAGAGCTCAACTTG

CTTCAGAAGCTGTATGGCTTGTACGACACTGTCATGGGCAGCATCAGTGGCTACTATGAGATCCTCTGGGGAGATGTAGACATCGAAAAGATCAATGCAG

AGCTGCAGGAATTCCAGAACAG ATGTCGAAAACTCCCCAGGGCACTCAAAGATTGGCAGGCGTTTCTGGACCTCAAAAAAAGAATCGACGACTTTAGTG

AGTCGTGTCCGCTGCTGGAGATGATGACCAATAAAGCGATGAAGCAGAGGCATTGGGACCGCATCTCAGAGCTCACCGGCACCCCGTTCGATGTGGAATC

GGATACATTCTGTCTGAGAAATATCATGGAAGCGCCACTCCTTAAGAACAAGGATGATATCGAA GATATCTGCATATCTGCCATTAAGGAGAAGGACAT

CGAAGCCAAGCTGACACAGGTGATTGAGAACTGGACCTACCAAAACCTGAGTTTTGCAGCGTTTAAGGGCAAAGGCGAGCTCCTGCTCAAAGGAACAGAG

TCTGGAGAGATTATCACCTTAATGGAGGATAGCTTGATGGTCCTAGGCTCCTTGCTAAGCAACAG ATACAATACCCCGTTTAAAAAAAATATCCAGAAT

TGGGTCTTTAAATTGTCCACTTCCTCGGATATCATTGAAGAGTGGCTGATAGTCCAGAACCTGTGGGTCTATCTTGAAGCTGTCTTTGTGGGTGGCGACA

TTGCCAAACAGCTGCCGCAG GAAGCCAAGCGTTTCCAGAATATTGACAAGTCATGGATAAAGATCATGCAGCGAGCTCATGAGAACCCCAACGTGATCA

GCTGCTGTGTCGGGGATGAGACCATGGGGCAGCTCCTGCCCCATTTACACGAGCAGTTGGAAGTCTGTCAGAAGTCCCTCACAGG GTATTTGGAAAAGA

AGAGGTTGCTATTTCCAAGATTCTTCTTTGTCTCCGATCCGGTTCTGCTGGAAATCCTCGGACAGGCCAGCGACTCCCACACCATTCAG CCACATCTCC

CTGCAGTGTCTGACAACATCAATGAGGTGACCTTCCATGCTAAAGACTACGATCGGATGACGGCCGTTATATCAAGAGAAGGAGAAAAAATCATG CTGG

ATACTCCCGTTATGGCCAAAGGGCCTGTAGAAATTTGGCTTCTGGACTTGTTAAAAGTACAGATGTCATCACTCCATAATATCATCCGGTCTGCCTTCTA

CCAGATCAGCGATTCGGGCTTTCTCCTCCTACCTTTCCTGAACCACTTCCCAGCACAG GTTGGGCTTCTGGGAATTCAAATGTTATGGACACATGACTC

AGAAGAGGCTTTGAATAATGCAAAAGACGACAGGAAAATCATGCAAATAACCAACCAGAAATTTTTGGACATTCTAAACACGCTGATTAGCCAGACGACG

CATGACCTGACCAAGTTTGACAGAGTGAAGTTTGAAACTTTGATCACAATCCATGTGCACCAGAGAGATATCTTTGATGACTTG GTAAAAATGCACATC

AAGTCGGTCACCGACTTCGAGTGGCTGAAACAGAGCAGATTTTATTTCAAAGAGGATTTGGATCAGACCGTGGTGTCCATCACCGATGTGGACTTCATTT

ACCAAAACGAGTTCCTGGGATGCACGGATCGCCTTGTGATCACCCCGTTAACAGATAG ATGCTACATCACGCTGGCTCAGGCTCTGGGAATGAACATGG

GCGGTGCTCCAGCAGGACCCGCCGGGACGGGTAAAACCGAAACCACAAAAGACATGGGCAGGTGTTTGGGCAAGTATGTGGTTGTGTTCAATTGTTCCGA

TCAGATGGATTTCCGAGGCCTCGGACGGATTTTCAAAG GTCTTGCACAGTCCGGTTCCTGGGGTTGCTTTGATGAGTTTAACAGAATTGAATTGCCCGT

TTTATCTGTGGCGGCGCAACAAATTTACATAGTTTTGACAGCGAGGAAAGAGAGGAAAAAACAGTTCATCTTCTCAGATGGCGATTGTGTGGATTTAAAT

CCAGAATTCGGAATCTTCCTAACCATG AACCCTGGATATGCCGGGCGCCAGGAACTGCCAGAAAACTTAAAAATCCAGTTTAGAACAGTTGCAATGATG

GTTCCTGATCGGCAG ATCATTATGCGAGTTAAGCTTGCTAGCTGTGGCTTTCTTGAAAATGTTATCTTGGCGCAGAAGTTTTATGTTCTCTATAAACTC

TGCGAAGAGCAGCTTACTAAACAG GTCCACTATGACTTTGGACTGAGAAATATCCTGTCTGTGCTGAGGACCCTTGGGTCTCAGAAAAGAGCTCGGCCA

GAAGACAGTGAGTTAAGCACGGTCATGAGAGGGCTACGAGACATGAACCTTTCTAAACTG GTTGACGAAGATGAGCCTCTGTTCCTCAGCTTGATCAAC

GACCTGTTTCCGGGGTTACAACTGGACAGCAGTACTTACGCGGAACTGCAATCCGCGGTGGACAACCAGGTTAACCTAGAAGGTCTGATAAACCACCCAC

CCTGGAACCTCAAATTAGTGCAG TTATATGAGACCTCTCTGGTACGGCATGGCCTGATGACCCTCGGGCCCAGCGGTTCTGGGAAGACGACGGTCATAA

CAATTCTGATGAAATCATTAACGGAGTGTGGGAGGCCTCACAGAGAGATGCGAATGAATCCAAAGGCGATTACCGCGCCTCAGATGTTCGGCAGGCTGGA

TACAGCCACCAACGACTGGACAGATGGGATCTTTTCCACTCTGTGGAGGAAGACATTAAAAGCTAAAAAGG GTGAGAACATCTTCCTCATCCTAGACGG

CCCCGTGGATGCCATCTGGATTGAGAACTTAAACTCCGTGTTGGACGATAACAAGACGCTCACCCTGGCTAACGGGGACCGCATCCCCATGGCCCCTACC

TGTAAGCTGCTGTTTGAGGTGCACAACATTGAGAACGCCTCTCCTGCCACGGTGTCAAGGATGGGCATGGTATACATCAGCAGCTCGGCTCTCAGCTGGA

GGCCGATATTACAG GCATGGTTGAAGAAGCGCAGCCAGCAGGAAGCCTCCGTCTTCCTGAGTCTGTATGATAAGGTGTTTGAAGACGCATACACGTACA

TGAAACTAAGCCTCAACCCCAAGATGCAGCTCCTGGAGTGTAATTACATCATGCAG TCTCTCAATCTCCTGGAAGGTTTAATCCCTTCCAAAGAAGAAG

GTGGCGTCTCGTCGGGGGACCACCTCCACAAGCTGTTTGTGTTTGGTCTGATGTGGAGCCTGGGAGCCCTTTTGGAACTGGATAGCAGGGAAAAACTGGA

AGTCTTCCTCCGAGGTCACGGGAGCAAGCTGAACCTGCCGGAGATACCCAAGGGCTCCCAGCAGACTATGTATGAGTTTTACGTTACCGACTACG GTGA

CTGGGAGCACTGGAACAAGAGAATTCAGCCATACTTCTATCCGACGGACAGCATTCCAGAGTACTCTTCCATCTTGGTTCCAAATGTGGACAACATCAGG

ACCAACTTCTTGATAGACACGATCGCGAAACAGCACAAA GCGGTTTTGCTCACGGGAGAACAGGGCACGGCAAAAACGGTAATGGTGAAGGCGTACCTG

AAGAAATACGACCCTGAAGTGCAGCTGTCCAAGAGTCTGAATTTTTCCTCTGCTACAGAGCCAATGATGTTTCAG AGGACAATCGAAAGCTACGTGGAT

AAGAGGATGGGGAGTACCTACGGCCCCCCAGGAGGGAGGAAGATGACGGTGTTTATTGATGATATTAATATGCCCGTGATCAACGAATGGGGAGATCAG 

ATCACCAATGAGATCGTGCGTCAGATGATGGAGATGGAGGGAATGTACAGCTTGGACAAGCCTGGAGACTTCACCACCATTGTCGATGTGCAGCTCATAG

CAGCCATGATCCATCCTGGAGGAGGGCGGAACGACATCCCACAGCGCTTAAAAAGGCAGTTTACCGTGTTCAACTGCACGCTGCCTTCCAACACGTCTAT

TGACAAAATCTTCG GAATTATCGGCTGTGGATACTTTGACCCGTGTAGAAAGTTCAGACCCGAAATATGTGACATGGTTGGGAATTTGGTCTCAGTCAG

CCGCGTACTGTGGCAGTGGACAAAG GTAAAGATGCTACCCACGCCTTCAAAGTTTCATTACATCTTCAACCTCCGGGACCTTTCGAGAATCTGGCAGGG

GATGTTAACCGTAAAAGCAGAAGAGTGCAGCTCGATCCCCATTCTCCTGTCGCTCTTCAAGCACGAGTGTAACAGAGTGATCGCAGACAG GTTTATAAC

TCCGGATGACGAGCAGTGGTTCAACTCACAGCTCATTCGGGCGGTGGAAGAAAACATCAGCCCAGAGGTCGCAGCCAATATCCTCCCTGAACCATACTTT

GTGGATTTTCTCCGAGATATGCCGGAGCCCACTGGTGACGAACCCGAAGACACTATGTTTGAAGTGCCCAAAATCTACGAATTG GTGCCGTCCTTCGAA

TTCCTGAGTGAAAAGCTTCAGTTCTACCAGAGGCAATTCAACGAGATCATCCGAGGGACGTCTCTCGACCTGGTGTTTTTTAAAGACGCCATGACTCACC

TCGTTAAG ATCTCTCGGATCATTCGAACCTCCTGTGGGAACGCATTGCTGGTGGGTGTCGGTGGCTCAGGAAAGCAGAGCCTCTCAAAACTGGCCTCCT

TTATTGCTGGGTATCAGATATTTCAGATAACACTAACCAG GTCTTACAACGTAAGCAACCTCATAGAAGACCTAAAGAATTTGTACAAAGTTGCTGGCG

CGGAAGGCAAAGGCATCACCTTCATCTTTACGGACAATGAGATAAAAGATGAGGCGTTCCTGGAATACCTTAATAATCTGCTGTCTTCAGGGGAG ATCT

CCAATTTATTTGCCCGAGACGAGATGGATGAAATCACCCAAGGCCTGATATCGGTGATGAAGAGGGAGCTGCCTCGACACCCTCCCACCTTTGACAACCT

GTATGAATACTTCATCACCAGATCCAGGAAGAATTTACATGTTGTTCTCTGCTTCTCCCCG GTTGGAGAGAAGTTCCGGGCCCGGTCCCTCAAATTCCC

TGGCTTGATTTCAGGGTGCACCATGGACTGGTTCAGTCGCTGGCCCAAGGAGGCTCTAATCGCTGTGGCCTCATACTTCCTTTTAGATTATAACATTGTC

TGCTCCATTGAGACTAAGAGGCATGTTGTAGAAACTATGGGGCTCTTTCATGACATGGTTTCTGAAAGCTGCGAGAATTACTTCCAAAG ATACCGCCGA

AGAGCCCACGTGACTCCCAAATCATATCTCTCATTTATAAATGGTTATAAAAGCATTTACACCGATAAGGTGAAATATATCAATGAACAAGCGGAACGGA

TGAATATCG GTCTCGACAAGCTGATGGAGGCGAGCGAATCTGTGGCTAAGCTCTCACAGGATCTCGCAGTGAAGGAGAAGGAACTGGCGGTGGCTTCCA

TTAAAGCAGACGAA GTCCTGGCAGAGGTCACAGTGAGTGCCCAGGCTTCAGCCAAAGTGAAAAACGAAGTCCAGGAAGTAAAAGATAAAGCTCAGAAAA

TTGTGGATGAAATTGACAGCGAGAAGGTGAAAGCAGAGACTAAGCTGGAGGCCGCCAAACCTGCCCTGGAAGAAGCAGAAGCAGCCCTGAAT ACCATCA

AACCAAATGACATTGCCACAGTCAGGAAGCTTGCCAAACCACCACATCTCATTATGAGAATCATGGACTGTGTCCTGTTGCTGTTCCAAAAGAAAATCGA

TCCTGTTACCATGGACCCAGAAAAGCCCTGCTGCAAGCCATCATGGGGAGAGTCGTTAAAG CTGATGAGCGCCACCGGGTTCCTGTTCAGCCTGCAGCA

GTTCCCCAAGGACACAATCAACGAGGAAACTGTTGAACTACTGCAGCCATATTTTAACATGGACGACTACACTTTTGAAAGTGCCAAAAAAGTGTGTGGC

AACGTGGCTGGGCTGCTTTCCTGGACACTTGCTATGGTGATATTTTACGGCATCAACAGGGAAGTGTTGCCCTTGAAG GCAAACCTGGCCAAGCAGGAA

GGCCGCTTGGCTGTGGCCAATGTGGAATTAGGGAAGGCCCAGGCGCTGCTGGACGAGAAGCAGGCTGAGCTGGATAAAGTGCAGGCCAAGTTTGACGCCG

CGATGAAGGAGAAAATG GACCTGCTCAATGATGCCGACATGTGCAGGAAGAAGATGCAGGCAGCCTCCACGCTCATTGATGGCCTGAGTGGGGAGAAAG

TCCGGTGGACCCAGCAAAGTAAGGAGTTCAAGACGCAGATTAATAG ACTCGTAGGCGATGTTCTGCTCTGCACAGGCTTTCTCTCCTACCTCGGCCCCT

TCAATCAGATATTTCGGAACTATTTGCTTAAAGACCAATGGGAGTTAGAGTTGAAAGCACGGAAAATTCCTTTCACTGAAAACCTGAATCTTATTGCAAT

GTTGGTGGACCCTCCAACA ATTGGCGAGTGGGGCCTGCAGGGACTCCCTGGAGATGACTTGTCAATTCAGAATGGCATCATTGTGACAAAGGCCACCAG

ATACCCTCTGCTCATTGATCCCCAGACTCAGGGAAAAACGTGGATCAAATCGAAGGAAAAAGAAAACGACTTGCAG GTGACATCTCTGAACCACAAATA

TTTCCGCACACACCTGGAGGACAGCCTCTCGTTGGGTCGCCCCCTTCTCATCGAGGATATTCGAGAGGAGCTGGACCCAGCTCTGGATAATGTGCTGGAG

AAGAACTTTATCAAATCAGGCACTGCTTTCAAG GTGAAAGTGGGTGACAAGGAATGTGACATCATGGACACGTTTAAACTTTACATCACCACGAAGTTA

CCAAACCCTGCCTTCACCCCTGAGATCAACGCCAAGACGTCCGTCATTGATTTCACTGTCACCATGAAGGGACTCGAGAACCAGTTACTCAGGAGAGTCA

TTCTCACAGAGAAACAG GAGCTGGAGTCGGAGAGGGTGAAGCTCCTCGAGGACGTGACTTTCAATAAGCGGAAGATGAAGGAGCTGGAAGACAACCTGC

TATATAAGCTGAGCGCCACAAAAG GTTCCCTGGTGGACGACGAGTCTCTCATCGGCGTCCTGCGCATCACCAAACAGACAGCTGCGGAAGTGAGCGAAA

AGCTCCACGTGGCTGCGGAAACGGAGATCAAGATCAATACAGCTCAGGAGGAGTTCCGGCCAGCGGCCACGCGAGGCAGCATCCTTTACTTCCTCATCAC

AGAGATGAGCATGGTCAACATCATGTACCAAACCTCCCTGGCCCAGTTCTTGAAGTTATTTGACCAGTCCATGGCCAG GTCTGAAAAGTCTCCGCTACC

TCAAAAAAGAATTACAAACATTATTGAGTACCTGACATACGAGGTCTTCACCTATTCTGTGAGAGGCCTGTACGAAAACCACAAATTCCTCTTCGTTCTC

CTCATGACACTGAAGATCGATCTCCAGAGAGGGACAGTGAAGCACAAAGAGTTTCAGGCTCTGATTAAAG GTGGAGCAGCCCTGGACCTGAAGGCATGC

CCCCCCAAGCCCTTCCGCTGGATCCTGGACATGACGTGGCTGAACCTTGTGGAGCTCAGTAAGCTCCCCCAGTTTGCAGAAATTATGAACCAG ATATCT

CGGAACGAGAAGGGGTGGAAAAACTGGTTTGATAAAGACGCCCCAGAGGAAGAGATCATCCCTGATGGCTATAATGACTCCCTGGATACCTGCCGCAAGC

TTCTGCTTATCAG ATCATGGTGCCCTGACCGCACTGTTTTCCAAGCGAGAAAGTATATCGCGGACTCTCTCGAGGAGAAGTACACGGAGCCAGTTATCC

TAAATCTGGAGAAGACCTGGGAAGAAAGTGACACGCACACACCTCTGATCTGTTTCCTGTCCATGGGCTCCGACCCCACCATCCAGATTGATGCGTTGGC

CAAGAAGCTGAAGCTGG AATGCAGGACTATCTCAATGGGACAAGGACAAGAAGTTCATGCTCGAAAGCTGATCCAGTTGTCCATGCAACAG GGTGGTT

GGGTGTTACTGCAGAATTGTCACCTCGGTCTAGAATTCATGGAAGAGTTACTAGAGATGTTGATGGTCACAGAAACCACCGAAGACTCCTTCAGAGTGTG

GATAACCACTGAGCCCCATGATCGGTTTCCAATTACACTACTCCAG ACTTCTATCAAGTTCACAAATGAGCCACCCCAAGGTGTCCGGGCAGGCCTGAA

AAGGACATTCGCTGGGATCAACCAAGACCTTCTGGACATCAGTAACTTACCCATGTGGAAGCCGATGCTGTACACGGTGGCATTTCTGCACTCCACCGTG

CAG GAGCGACGAAAATTTGGACCCTTGGGATGGAATATTCCCTATGAATTCAATTCTGCCGACTTCTCGGCCAGCGTTCAGTTTATTCAGAACCACCTC

GATGAGTGTGATATTAAAAAG GGTGTGTCGTGGAGTACAGTTCGGTACATGATTGGTGAAGTACAGTACGGAGGCAGAGTGACAGATGACTTCGACAAA

AGGCTGCTTAACTGCTTTGCCCGG - UNI29202 - GTCTGGTTCAGTGAGAAGATGTTTGAGCCCTCGTTCTGTTTTTACACCGGCTACAAAATCCC

CATATGCAAAACCCTGGACCAGTATTTTGAGTTCATCCAGTCTCTGCCATCCCTCGATAACCCAGAAGTCTTTGGGCTTCACCCCAATGCCGACATCAC 

GTATCAGAGTAACACAGCTTCCGACGTTCTTGAAACCATCACCAACATTCAACCGAAAGAGAGCGGTGGTGGTGTGGGCGAGACGCGCGAGGCCATTGTC

TACAGGCTGTCTGAGGACATGCTCAGCAAGCTGCCCCCTAACTATGTGCCTCATGAG GTGAAAGCTCGCTTGATGAAGATGGGGCACCTGAACTCAATG

AACATATTTCTTAGACAGGAAATTGACAGGATGCAGAAAGTCATCTCAATCCTCCGCAGCAGCCTGAGTGACCTAAAACTGGCTATCGAAGGGACGATCA

TCATGAGTGAG AACTTGAGAGATGCGTTGGATAACATGTATGATGCTCGTATACCTCAGCTTTGGAAGAGGGTGTCCTGGGACTCCTCCACCCTGGGCT

TCTGGTTCACCGAACTTCTGGAAAGGAACGCCCAGTTCTCGACATGGATATTTGAGGGGAGGCCTAACGTGTTCTGGATGACCGGGTTCTTTAACCCCCA

AG GCTTCCTCACAGCAATGAGGCAAGAAGTGACCCGAGCTCACAAAGGCTGGGCGCTGGACACTGTGACCATCCACAATGAAGTCCTGCGGCAGACCAA

GGAAGAGATCATCACGCCCCCAGCG - UNI28896 - GAAGGCGTGTATATTTACGGGCTGTATATGGATGGAGCATCCTGGGACAGGCGGAACGGGA

AGCTCACAGAATCCACCCCGAAGGTTCTCTTCACGCAGCTTCCTGTTCTGCATATTTTTGCCATTAACTCCACGGCGCCCAAGGATCCGAAGCTGTACGT

GTGTCCTATCTACAAGAAACCCAGGCGGACTGACCTCACCTTCATCACCGTGGTGTACCTGCGCACGGTGCTGTCCCCGGATCACTGGATCCTGAGAGGG

GTGGCCCTCTTGTGTGACATCAAGTAAGTTCATCTCTATCTGCCGTGGGCACCAGGAGAGCCACACAGAAAAAAGCTTGCCACTGAGAAACTCAGACATG

CTTATGTCTCCTGCCTGATAGGTGCTTCATTACCCTCCCTCAATTAAACAGTTGACACTTCT
Translation
 - UNI21347 - MESEEGNAEPPPPSEEAPPPVVEEAPPPLPPEDTAPPPPEEQAPPPEGDAAPPPTGDAFQLTVEGEAPHPEDPKLLSEQGPATSVT

DYRSLIPSDEEVTLPEDEESGQARVRARHTPRPAQSVLSDGISQSSRRPSKFRRSMTGIPNLQETLKEKQ ARFREARENRKMKIGPSHKYIFEVLGEKL

GLDLVTVEELILDCPS - UNI7869 - LDPFTSFFEKGGCKTLKFLYQEGEVPGFE ECGRTITGVPKGGKMMRIYVDNAAPDKLKGLCLFFVRCRND

VAINSKTIHE DVLFSFLDASKGLLEGIKHMLKSIFLPAILATSNWGALNQSKQGESEKHIFIETIHRYLASLDD DATISIEGTVMLKKVDNIDFSKLH

TFEEVTAAASSSEMVHQLEEVLMVWYKQIEQ VLIESEQMRKEADDSGPLTELEHWKRMSAKFNFIIEQIKGSNCKAVINVLNVAHSKLLK - UNI328

23 - NWRDLDARITDSANESKDNVRYLYTLEKVCQPLYNYDL VSMAHGIQNLINAIRMIHSVSRYYNTSERMTSLFIK VTNQMVTACKAYITDGGTN

HVWDQETPAVLKKIQ DCIFLFKEYQASFHKTRKQILESSGEKSFEVSEMYIFGKFEAFCKRLEK ITEMITIVQTYSALSNSTIEGIDILGIKFKNIYQ

GIKKNQYDILDPRRTEFDTDFTEFMGKINILE IQIQAFMNSTFGKILSSQQALQLLQR RFQKLNIPCLHLEINHTIERILQCYVAELEFTKK LYLSQ

KDDPPLARNMPPIAGKILWVRQLFRRINEPINYFF KNSDILSSTEGKAVIRQYNRIAYVLVEFEVAYHTAWFKEVSQLQYA ALQATLFVRHPETGKLL

VNFDPKILEVVRETKCMIKMKLDVPEQAKNLLKLESKLKADKLYLQ GLLQYYDDLCQEVPSVFVNLMTPKMKK VESVLRQGLTVLTWSSLMLESFFKE

VESVLDMFNQLLKK VNDLCEMHIDTVLKEIAKTLLISLSDSGTTKVEDMLTLNE TYTKECADILNHKSRHVEEAVKELILIFEQIYEVKYTGKAAKSV

KE - UNI33307 - EQRKRVVFGSEAEETEGLDFESTTMEVDTNDKEDEFKK ECKEVYAFFSHQLLDSLQKATRLSLDTMKRRIFVGS SQGRRRSE

DIVSFIKTEVHLAIPNV VMVPSLDDIQQAINRMIQLTLEVSRGVAHWGQQQVRQIKSFQNNSRGSDQPPASGKPLKKEER RSFEETIPARKLKNFYPG

VAEHKDISKLVLLLSSSVNSLRKAATEALQDFQKYKTLWIEDRHVKVK EFLANNPSLTEIRSEILHYATLEQEIKELKPIIVVGSLELHTE EPMKLAL

SIEAKAWKMLLCRYLNEEYKKKMSDMITFINEYLKKLSRPIRDLDDVRFAMEALSCIRDNEIQMDMTLGPIE EAYGILNRFEVKVTKEESEGVDTLRYS

FNKLQSKA VSVQGELVKVQPKFKSNLLESVKVFCEDVINFTEAYET EGPMVPNIPPQEASNRLQIFQ ANFDDLWRKFVTYSSGEQLFGLPVTDYEVL

HKTR RKELNLLQKLYGLYDTVMGSISGYYEILWGDVDIEKINAELQEFQNR RCRKLPRALKDWQAFLDLKKRIDDFSESCPLLEMMTNKAMKQRHWDR

ISELTGTPFDVESDTFCLRNIMEAPLLKNKDDIE DICISAIKEKDIEAKLTQVIENWTYQNLSFAAFKGKGELLLKGTESGEIITLMEDSLMVLGSLLS

NR RYNTPFKKNIQNWVFKLSTSSDIIEEWLIVQNLWVYLEAVFVGGDIAKQLPQ EAKRFQNIDKSWIKIMQRAHENPNVISCCVGDETMGQLLPHLHE

QLEVCQKSLTG GYLEKKRLLFPRFFFVSDPVLLEILGQASDSHTIQ PHLPAVSDNINEVTFHAKDYDRMTAVISREGEKIM LDTPVMAKGPVEIWLL

DLLKVQMSSLHNIIRSAFYQISDSGFLLLPFLNHFPAQ VGLLGIQMLWTHDSEEALNNAKDDRKIMQITNQKFLDILNTLISQTTHDLTKFDRVKFETL

ITIHVHQRDIFDDL VKMHIKSVTDFEWLKQSRFYFKEDLDQTVVSITDVDFIYQNEFLGCTDRLVITPLTDR RCYITLAQALGMNMGGAPAGPAGTGK

TETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKG GLAQSGSWGCFDEFNRIELPVLSVAAQQIYIVLTARKERKKQFIFSDGDCVDLNPEFGIFLTM 

NPGYAGRQELPENLKIQFRTVAMMVPDRQ IIMRVKLASCGFLENVILAQKFYVLYKLCEEQLTKQ VHYDFGLRNILSVLRTLGSQKRARPEDSELSTV

MRGLRDMNLSKL VDEDEPLFLSLINDLFPGLQLDSSTYAELQSAVDNQVNLEGLINHPPWNLKLVQ LYETSLVRHGLMTLGPSGSGKTTVITILMKSL

TECGRPHREMRMNPKAITAPQMFGRLDTATNDWTDGIFSTLWRKTLKAKKG GENIFLILDGPVDAIWIENLNSVLDDNKTLTLANGDRIPMAPTCKLLF

EVHNIENASPATVSRMGMVYISSSALSWRPILQ AWLKKRSQQEASVFLSLYDKVFEDAYTYMKLSLNPKMQLLECNYIMQ SLNLLEGLIPSKEEGGVS

SGDHLHKLFVFGLMWSLGALLELDSREKLEVFLRGHGSKLNLPEIPKGSQQTMYEFYVTDYG GDWEHWNKRIQPYFYPTDSIPEYSSILVPNVDNIRTN

FLIDTIAKQHK AVLLTGEQGTAKTVMVKAYLKKYDPEVQLSKSLNFSSATEPMMFQ RTIESYVDKRMGSTYGPPGGRKMTVFIDDINMPVINEWGDQ 

ITNEIVRQMMEMEGMYSLDKPGDFTTIVDVQLIAAMIHPGGGRNDIPQRLKRQFTVFNCTLPSNTSIDKIFG GIIGCGYFDPCRKFRPEICDMVGNLVS

VSRVLWQWTK VKMLPTPSKFHYIFNLRDLSRIWQGMLTVKAEECSSIPILLSLFKHECNRVIADR RFITPDDEQWFNSQLIRAVEENISPEVAANILP

EPYFVDFLRDMPEPTGDEPEDTMFEVPKIYEL VPSFEFLSEKLQFYQRQFNEIIRGTSLDLVFFKDAMTHLVK ISRIIRTSCGNALLVGVGGSGKQSL

SKLASFIAGYQIFQITLTR RSYNVSNLIEDLKNLYKVAGAEGKGITFIFTDNEIKDEAFLEYLNNLLSSGE ISNLFARDEMDEITQGLISVMKRELPR

HPPTFDNLYEYFITRSRKNLHVVLCFSP VGEKFRARSLKFPGLISGCTMDWFSRWPKEALIAVASYFLLDYNIVCSIETKRHVVETMGLFHDMVSESCE

NYFQR RYRRRAHVTPKSYLSFINGYKSIYTDKVKYINEQAERMNIG GLDKLMEASESVAKLSQDLAVKEKELAVASIKADE VLAEVTVSAQASAKVK

NEVQEVKDKAQKIVDEIDSEKVKAETKLEAAKPALEEAEAALN TIKPNDIATVRKLAKPPHLIMRIMDCVLLLFQKKIDPVTMDPEKPCCKPSWGESLK

 LMSATGFLFSLQQFPKDTINEETVELLQPYFNMDDYTFESAKKVCGNVAGLLSWTLAMVIFYGINREVLPLK ANLAKQEGRLAVANVELGKAQALLDE

KQAELDKVQAKFDAAMKEKM DLLNDADMCRKKMQAASTLIDGLSGEKVRWTQQSKEFKTQINR RLVGDVLLCTGFLSYLGPFNQIFRNYLLKDQWELE

LKARKIPFTENLNLIAMLVDPPT IGEWGLQGLPGDDLSIQNGIIVTKATRYPLLIDPQTQGKTWIKSKEKENDLQ VTSLNHKYFRTHLEDSLSLGRPL

LIEDIREELDPALDNVLEKNFIKSGTAFK VKVGDKECDIMDTFKLYITTKLPNPAFTPEINAKTSVIDFTVTMKGLENQLLRRVILTEKQ ELESERVK

LLEDVTFNKRKMKELEDNLLYKLSATKG GSLVDDESLIGVLRITKQTAAEVSEKLHVAAETEIKINTAQEEFRPAATRGSILYFLITEMSMVNIMYQTS

LAQFLKLFDQSMAR RSEKSPLPQKRITNIIEYLTYEVFTYSVRGLYENHKFLFVLLMTLKIDLQRGTVKHKEFQALIKG GGAALDLKACPPKPFRWIL

DMTWLNLVELSKLPQFAEIMNQ ISRNEKGWKNWFDKDAPEEEIIPDGYNDSLDTCRKLLLIR RSWCPDRTVFQARKYIADSLEEKYTEPVILNLEKTW

EESDTHTPLICFLSMGSDPTIQIDALAKKLKLE ECRTISMGQGQEVHARKLIQLSMQQ GGWVLLQNCHLGLEFMEELLEMLMVTETTEDSFRVWITTE

PHDRFPITLLQ TSIKFTNEPPQGVRAGLKRTFAGINQDLLDISNLPMWKPMLYTVAFLHSTVQ ERRKFGPLGWNIPYEFNSADFSASVQFIQNHLDEC

DIKK GVSWSTVRYMIGEVQYGGRVTDDFDKRLLNCFAR - UNI29202 - VWFSEKMFEPSFCFYTGYKIPICKTLDQYFEFIQSLPSLDNPEVFGL

HPNADIT TYQSNTASDVLETITNIQPKESGGGVGETREAIVYRLSEDMLSKLPPNYVPHE VKARLMKMGHLNSMNIFLRQEIDRMQKVISILRSSLSD

LKLAIEGTIIMSE NLRDALDNMYDARIPQLWKRVSWDSSTLGFWFTELLERNAQFSTWIFEGRPNVFWMTGFFNPQG GFLTAMRQEVTRAHKGWALDT

VTIHNEVLRQTKEEIITPPA - UNI28896 - EGVYIYGLYMDGASWDRRNGKLTESTPKVLFTQLPVLHIFAINSTAPKDPKLYVCPIYKKPRRTDL

TFITVVYLRTVLSPDHWILRGVALLCDIK

For any suggestions or comments, please send an email to unitrap@crg.es