Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034055 (Phka1)
Chromosomal location
Chr X: 99709314 - 99839585 (-)
Description
phosphorylase kinase alpha 1 Gene [Source:MGI (curated);Acc:Phka1-003]
Human Ortholog
not available
Omim not available
UniTrap UNI37593
Vector Insertion
Chr X: 99770303 - 99781551
Public Clones (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120270
Sequence
AAGGGAGGCGGCACCCGGGGCGCTGACCCGCTGCTGTCGCCGGCCTTCAGTCTCAGGGCCGCCCCGGTCTCCTTCAGTCAAGCGGAGGATGCCGGTGCGC

CACCCGGGGACCACGGGAGACTGAGTGGAGACGGGGTCTTTGCCGGCCGAAGCCTAGACCGCGGGAGGCTGAGCCGCGGCCTGAAGTGGACTCTGAGGCC

GCCGGAACCAGGTGACGCGCGGGAACCATTGGCCACACGAGCAAGGGAGCGTTTAGAAGGTTTCCGTAGGCCTGGCGTCCGAGCTTCCCGTGTGTGCAGT

GGGGGATTAGGGACGTGGCACCATGAGGAGCCGCAGTAACTCGGGAGTCCGCCTGGACGGCTATGCTCGGCTGGTGCATCAGACCATCCTGTGCCATCAG

 AATCCAGTGACAGGCTTGCTTCCAGCCAGCTATGATCAAAAAGATGCCTGGGTCCGAGATAATGTGTACAGTATCCTGGCTGTGTGGGGTTTGGGCCTG

GCATATCGCAAAAATGCTGACCGTGATGAGGACAAGGCAAAGGCCTATGAACTGGAGCAG AGTGTAGTGAAGTTAATGAGGGGACTGCTGCACTGCATG

ATCAGACAG GTGGATAAAGTAGAGTCCTTCAAGTACAGTCAGAGTACTAAAGATAGCCTCCATGCCAAGTACAACACCAAAACTTGTGCCACTGTGGTG

GGTGATGACCAGTGGGGACACCTGCAGTTGGATGCTACTTCTGTGTACCTGCTCTTCCTAGCACAAATGACTGCCTCAG GACTCCATATCATCCACAGC

CTAGACGAAGTCAATTTTATACAGAACCTCGTGTTTTACATTGAAGCTGCATATAAAACTGCT GACTTTGGGATATGGGAACGTGGCGATAAGACAAAC

CAAGGCATCTCGGAATTGAATGCGAGTTCAGTTGGAATGGCCAAG GCAGCCCTGGAAGCACTAGATGAATTAGACTTGTTTGGTGTGAAAGGTGGGCCA

CAATCAGTTATCCATGTCCTGGCTGATGAAGTCCAACACTGCCAG TCTATCCTGAATTCACTACTGCCCAGGGCTTCAACATCCAAAGAAGTTGATGCC

AGTCTGCTCTCAGTGGTCTCTTTCCCAGCCTTTGCTGTAGAGGACAGCCATTTGGTGGAGCTCACCAAACAGGAGATCATCACCAAGCTTCAG GGTCGT

TATGGTTGCTGTCGTTTTCTGCGAGATGGATATAAAACTCCTAAAGAG GATCCCAATCGCCTATACTATGAACCAGCTGAGCTGAAGCTATTTGAAAAC

ATTGAGTGCGAATGGCCATTGTTCTGGACATACTTTATCCTTGATGGGATCTTCAGTGGCAACGTAGAACAG GTTCAAGAATATAGAGAGGCTCTTGAT

GCAGTCCTCATCAAGGGCAAAAATGGAGTCCCTCTTCTTCCAGAGCTGTACAGTGTCCCTCCTGACAGG GTTGATGAAGAGTATCAAAATCCCCACACT

GTGGATCGAGTCCCTATGGGAAAATTGCCTCACATGTGGGGTCAGTCTCTATACATTTTAGGAAGCTTGATGGCAGAG GGATTTTTAGCTCCTGGAGAA

ATTGATCCCCTGAATCGTAGGTTTTCTACTGTGCCAAAGCCAGATGTGGTGGTTCAAG - UNI37593 - TCTCCATTCTGGCTGAAACAGAAGAAAT

CAAGGCCATTTTGAAGGACAAAGGAATTGATGTGGAGACCATTGCTGAAGTGTACCCCATAAGAGTACAGCCAGCTCGTATTCTCAGCCATATTTATTCT

AGTCTAG - UNI37593 - GATGCAACAGTAGAATGAAACTCAGTGGACGACCCTACAGGCTCATGGGTGTGCTTGGAACATCAAAACTTTATGACAT

TCGCAAAACTATCTTTACTTTCACTCCACAG - UNI37593 - TTTATAGACCAGCAACAGTTCTACCTGGCTCTGGACAACCAGATGATAGTAGAAA

TGCTCAGAACAGACCTTTCCTACCTCTGTAGCCGCTGGAGGATGACAGGCCAGCCCACGATCACTTTCCCTATCTCGCACACCATGCTTG ATGAAGATG

GAACCAGCTTGAATTCAAGTATCTTGGCAGCACTCCGAAAAATGCAGGATGGCTATTTTGGTGGGGCCAG GATCCAAACAGGTAAATTGTCAGAGTTTT

TGACAACATCTTGCTGCACACACTTAAGCTTCATGGACCCTGGACCTGAGGGTAAGCTGTACAGTGAAGATTATGATGAAGACTATGAAGATGATTTGGA

CTCTGGCAACTGGATGGACAGCTATGATTCAACAAGTAATG CTCGCTGTGGTGATGAAGTTGCCCGTTATTTAGACCGCCTTTTGGCACACACTGTTCC

CCATCCTAAACTAGCTCCTACCTCACGGAAGGGAGGGCTAGATCGGTTCCGAGCTGCTGTGCAAACAACTTGCGACTTAATGTCCTTGGTGGCCAAGGCC

AAGGAGCTGCATATACAGA ATGTTCACATGTATCTTCCTACAAAGTTATTTCAGCCTTCTCGTCCTTCACTCAACTTACTTGACTCCCCTGAGTCTCCA

CAAGATAGCCAG GTTCCTTCCGTTCATGTAGAAGTGCATCTTCCTAGGGACCAGTCTGGGGAAGTGGACTTCCAGTCATTGGTTTCACAGTTGAAGGAG

ACCTCAAGCTTACAGGAGCAAGCTGATATACTCTACATGCTGTATTCAATGAA AGGACCTGACTGGAACACTGAATTGTATGAAGAAGGGGGGGCTACT

GTCAGAGAGCTTCTTAGTGAACTGTATGTCAAAGTTGGTGAAATTCGGCACTGGGGTCTGATCCGATATATCTCTGGGATCTTACGGAAGAAAGTGGAGG

CACTTGATGAG GCCTGCACAGACCTTCTGTCCTACCAGAAACACCTGACAGTAGGACTTCCTCCAGAACCTCGAGAGAAGACCATCTCTGC GCCTCTA

CCGTACGAGGCACTCACTAAGCTGATAGATGAAGCCAGTGAAGGCGACATGAGCATCTCAACCCTTACACAG GAAATAATGGTCTATCTTGCCATGTAT

ATGAGAACTCAGCCTGGCCTCTTTGCAGAAATGTTCAGACTTCGAATCGGTTTGATCATACAAGTTATGGCAACAGAACTAGCACACTCTCTTCGATGTT

CAG CTGAGGAAGCCACAGAGGGCCTGATGAATCTCAGTCCTTCAGCCATGAAGAACCTCCTGCATCACATTCTCAGTGGCAAAGAGTTTGGAGTGGAAC

GAAGCG TTCGTCCCACTGATTCAAATGTGAGTCCTGCTATTTCCATCCATGAGATTGGTGCTGTTGGAGCAACAAAAACTGAACGAACTGGAATCATGC

AGTTAAAAAGTGAGATAAAGCAG GTGGAATTTCATAGGTTGTCTGTCTCAACTGAGAGTCAG TCCCCTGCAGCCTGTATTGCTGCAAGTAGTGGATCC

TTTCCTACGGTGTGTGATCATCAGACATCTAAAGATAGTCGTCAAGGCCAGTGGCAACGCAGGAGAAGGCTAGATGGAGCACTAAATAGAGTACCAATTG

GATTTTATCAAAAAGTATGGAAAATTTTGCAGAAA TGTCATGGGCTTTCTGTGGAAGGTTTTGTTCTTCCCTCTTCAACCACTAGGGAG ATGACCCCA

GGTGAGATTAAATTCTCTGTCCATGTGGAGTCTGTCCTGAATCGTGTCCCTCAGCCAGAATACCGCCAACTTCTGGTTGAAGCCATCCTTGTTCTCACCA

TGCTGGCAGATATTGAAATTCATAGCATTGGGAGCATCATTGCTGTGGAGAAAATAGTTCATATTGCCAACGACTTGTTCCTTCAAGAACAG AAAACCC

TCGGCGCAGATGATACCATGTTGGCAAAGGATCCTGCATCTGGCATCTGTACTCTCCTGTATGACAGTGCACCCAGTGGCAGATTTGGCACCATGACCTA

CCTCTCCAAGGCAGCTGCCACCTACGTGCAGGAGTTTCTGCCACACAGCCTCTGTGCCATGCAGTGAGGGCTGTGGGTTCTGCCTGTTAGAACACTTCAG

TAGCTAGCCCGTCTGGTTGATTGTGCATGGAACTGACATGTTAACACCTGATCACTCCCCCAGGCCCTTTTCCTGCCCCATCCCTCCTAGGAAGAGAGAA

CTTTGCTGACGATCTCACTACTTTTGAAGAAAAGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGG

TTCAACTGCGCCTGCAGTCACTATCCCTACTTTTGTGGTTCATAGAAGTCTGCATGTGCGTTGATTCTGTAGAGCTGTTAGTGGCTTAGTTTTTAAACTC

CTATTGGGGAGTAGGTATTAATAACTTATTCCTGTAAGTTGGTTTTCTTATTTGTTGGTTTTTACGTGTGTATATGAGTGGTGGGTATTGATTAGGCCAT

CATTTCAAGAGAGTAGATGCTAAGTTGGATTTCGTGCTGCTGTAAATTGGAACTGTCGACTCTAAGTGCCTTTACTTAGGAAAAGCCAGTACCACATCAT

GGCTTCCTTCTTCACTCAAAGGCTGCTTTGCTCTGAGTGGGGAAAGAGTGGGTGTTTTGTAGAAGCATTGCCTTTCATTGTTCTTTCTATATCTGTCCAC

AATGCCTACTGTCTCTGTGGTGAAATATTAAAATATGTAAGCTCACATGGAAGTTTAAGAATTTCTGTGTTAATACTTGGAATAACCCAGAGAAAAGAAG

CCAGAAGCCTAATTCCAGAGAGGAAGGGAAAGAAGTTCTGTAGGTAGTGCTTTACACATAGGGGGCCGAGAGAACATCAGAGGCAGGTAGGTTGCTTGTG

GACAGCCTTAGACACCAAATCCTTGCCTCTGGAGTGTAGCCACACACAACACAGAGAGTAACTGAAGCCTATCTTAAGCAAAGAGAAACCACCCGTCCAC

TCTGGGGCTGCCCTACTGAATGCCCCTTTCCAGGACCTTGGTATTCCTTCTCATTCAGTCCCCAGCACATCCGGCTACCCCTAGCTCTCTCCACATTCAT

TCCTCAAGTCTCTCATTTACATGGTTTGACTTTTTAATTCTAGTACTTACAACCTTTAATCTTGGTAACTGTGGCCAAATATCTATTGTTATACATATCT

CTGAATGTGCTTGTAAGTGGTTAAATAATTTGTAAGCATTTTTGATCTGTCTGTCTGTCTCTACATGGATGGACTGAATAAGAATGTAAATAATATTTAT

TGCAAAGCAAGCCTGGTCATACTTGCTGCTTGAGAAGCTGAGGCAGGAGGATCATGAATTCAAAGCCAGCCTGGGATACATAGCAAGTTTCAGGGCAGTG

TGGGTATGAGGTTGTGTCTCAAAAACATTTGAAAGCATGTTGTGCATGTGTGAGAGAGTGGCGTGGCTGGTCTCAGGCTGACACTCGAAGGGTAGTAGAA

ATATCCCTTCTGGCCTATTGTCTGCTTCGCTGTGTAGGTAGCCTGACTTGACAGAGGTTTCTCCTGGTTTTCCTTGTTTCTACCCAGAGAATTTCCTACT

CCCCTTTCCCTCCAAATGTTAAGGGTTTTCTCCCAGAACAGTAATGGGGCTAAAGGGGCAGTGAGCTCCAAACAGTCACAGAGTGAGGAGTCTTCTGAGC

TCCCTGGCTAAGTGCAGCGTGCTAGCAGACAGGCAGGGGATGCAAACGGCTGCCGGGCCACCTCTCCCCTCTCACAAACCATATAAACACAGGGAGGGGC

TTTCTCACCACTTCTGAGGAGACTGTACAGCCCGTTTTGTGCCTGTGTGTGTGTTCATGGCCTGTAAGTGTACCCCAAGCACTGTGGGCGGGAGCTACCA

CTTCTTTGAGAACCTCTGCTTTACGGTTGACACTGATGCTTATCTTTCTCTGGAGTTACGGATTTGCCTGTGGATTTAATGCTCACACCATGCTATTTAA

TTTTTAAAGTAACTTTTCAGAAAATATTACTGGCGTTTTGTTCATTTTAAGACTGTTAACATGAAGAAAAGTGTGCTAGAACTTTTTAAAAACACATAAT

GTCTTGAAGTTAGAATAAACACTAAGAAATGACT
Translation
MRSRSNSGVRLDGYARLVHQTILCHQ NPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQ SVVKLMRGLLHCMIRQ VD

KVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASG GLHIIHSLDEVNFIQNLVFYIEAAYKTA DFGIWERGDKTNQGI

SELNASSVGMAK AALEALDELDLFGVKGGPQSVIHVLADEVQHCQ SILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQ GRY

GCCRFLRDGYKTPKE DPNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQ VQEYREALDAVLIKGKNGVPLLPELYSVPPDR VDEEYQNPH

TVDRVPMGKLPHMWGQSLYILGSLMAE GFLAPGEIDPLNRRFSTVPKPDVVVQV - UNI37593 - VSILAETEEIKAILKDKGIDVETIAEVYPIR

VQPARILSHIYSSLG - UNI37593 - GCNSRMKLSGRPYRLMGVLGTSKLYDIRKTIFTFTPQ - UNI37593 - FIDQQQFYLALDNQMIVEML

RTDLSYLCSRWRMTGQPTITFPISHTMLD DEDGTSLNSSILAALRKMQDGYFGGAR RIQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDD

LDSGNWMDSYDSTSNA ARCGDEVARYLDRLLAHTVPHPKLAPTSRKGGLDRFRAAVQTTCDLMSLVAKAKELHIQN NVHMYLPTKLFQPSRPSLNLLD

SPESPQDSQ VPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYMLYSMK KGPDWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISG

ILRKKVEALDE ACTDLLSYQKHLTVGLPPEPREKTISA APLPYEALTKLIDEASEGDMSISTLTQ EIMVYLAMYMRTQPGLFAEMFRLRIGLIIQVM

ATELAHSLRCSA AEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSV VRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQ VEFHRLSVSTE

SQ SPAACIAASSGSFPTVCDHQTSKDSRQGQWQRRRRLDGALNRVPIGFYQKVWKILQK CHGLSVEGFVLPSSTTRE MTPGEIKFSVHVESVLNRVP

QPEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQ KTLGADDTMLAKDPASGICTLLYDSAPSGRFGTMTYLSKAAATYVQEFLPHS

LCAMQ
Transcript ENSMUST00000122022
Sequence
AAGGGAGGCGGCACCCGGGGCGCTGACCCGCTGCTGTCGCCGGCCTTCAGTCTCAGGGCCGCCCCGGTCTCCTTCAGTCAAGCGGAGGATGCCGGTGCGC

CACCCGGGGACCACGGGAGACTGAGTGGAGACGGGGTCTTTGCCGGCCGAAGCCTAGACCGCGGGAGGCTGAGCCGCGGCCTGAAGTGGACTCTGAGGCC

GCCGGAACCAGGTGACGCGCGGGAACCATTGGCCACACGAGCAAGGGAGCGTTTAGAAGGTTTCCGTAGGCCTGGCGTCCGAGCTTCCCGTGTGTGCAGT

GGGGGATTAGGGACGTGGCACCATGAGGAGCCGCAGTAACTCGGGAGTCCGCCTGGACGGCTATGCTCGGCTGGTGCATCAGACCATCCTGTGCCATCAG

 AATCCAGTGACAGGCTTGCTTCCAGCCAGCTATGATCAAAAAGATGCCTGGGTCCGAGATAATGTGTACAGTATCCTGGCTGTGTGGGGTTTGGGCCTG

GCATATCGCAAAAATGCTGACCGTGATGAGGACAAGGCAAAGGCCTATGAACTGGAGCAG AGTGTAGTGAAGTTAATGAGGGGACTGCTGCACTGCATG

ATCAGACAG GTGGATAAAGTAGAGTCCTTCAAGTACAGTCAGAGTACTAAAGATAGCCTCCATGCCAAGTACAACACCAAAACTTGTGCCACTGTGGTG

GGTGATGACCAGTGGGGACACCTGCAGTTGGATGCTACTTCTGTGTACCTGCTCTTCCTAGCACAAATGACTGCCTCAG GACTCCATATCATCCACAGC

CTAGACGAAGTCAATTTTATACAGAACCTCGTGTTTTACATTGAAGCTGCATATAAAACTGCT GACTTTGGGATATGGGAACGTGGCGATAAGACAAAC

CAAGGCATCTCGGAATTGAATGCGAGTTCAGTTGGAATGGCCAAG GCAGCCCTGGAAGCACTAGATGAATTAGACTTGTTTGGTGTGAAAGGTGGGCCA

CAATCAGTTATCCATGTCCTGGCTGATGAAGTCCAACACTGCCAG TCTATCCTGAATTCACTACTGCCCAGGGCTTCAACATCCAAAGAAGTTGATGCC

AGTCTGCTCTCAGTGGTCTCTTTCCCAGCCTTTGCTGTAGAGGACAGCCATTTGGTGGAGCTCACCAAACAGGAGATCATCACCAAGCTTCAG GGTCGT

TATGGTTGCTGTCGTTTTCTGCGAGATGGATATAAAACTCCTAAAGAG GATCCCAATCGCCTATACTATGAACCAGCTGAGCTGAAGCTATTTGAAAAC

ATTGAGTGCGAATGGCCATTGTTCTGGACATACTTTATCCTTGATGGGATCTTCAGTGGCAACGTAGAACAG GTTCAAGAATATAGAGAGGCTCTTGAT

GCAGTCCTCATCAAGGGCAAAAATGGAGTCCCTCTTCTTCCAGAGCTGTACAGTGTCCCTCCTGACAGG GTTGATGAAGAGTATCAAAATCCCCACACT

GTGGATCGAGTCCCTATGGGAAAATTGCCTCACATGTGGGGTCAGTCTCTATACATTTTAGGAAGCTTGATGGCAGAG GGATTTTTAGCTCCTGGAGAA

ATTGATCCCCTGAATCGTAGGTTTTCTACTGTGCCAAAGCCAGATGTGGTGGTTCAAG - UNI37593 - TCTCCATTCTGGCTGAAACAGAAGAAAT

CAAGGCCATTTTGAAGGACAAAGGAATTGATGTGGAGACCATTGCTGAAGTGTACCCCATAAGAGTACAGCCAGCTCGTATTCTCAGCCATATTTATTCT

AGTCTAG - UNI37593 - GATGCAACAGTAGAATGAAACTCAGTGGACGACCCTACAGGCTCATGGGTGTGCTTGGAACATCAAAACTTTATGACAT

TCGCAAAACTATCTTTACTTTCACTCCACAG - UNI37593 - TTTATAGACCAGCAACAGTTCTACCTGGCTCTGGACAACCAGATGATAGTAGAAA

TGCTCAGAACAGACCTTTCCTACCTCTGTAGCCGCTGGAGGATGACAGGCCAGCCCACGATCACTTTCCCTATCTCGCACACCATGCTTG ATGAAGATG

GAACCAGCTTGAATTCAAGTATCTTGGCAGCACTCCGAAAAATGCAGGATGGCTATTTTGGTGGGGCCAG GATCCAAACAGGTAAATTGTCAGAGTTTT

TGACAACATCTTGCTGCACACACTTAAGCTTCATGGACCCTGGACCTGAGGGTAAGCTGTACAGTGAAGATTATGATGAAGACTATGAAGATGATTTGGA

CTCTGGCAACTGGATGGACAGCTATGATTCAACAAGTAATG CTCGCTGTGGTGATGAAGTTGCCCGTTATTTAGACCGCCTTTTGGCACACACTGTTCC

CCATCCTAAACTAGCTCCTACCTCACGGAAGGGAGGGCTAGATCGGTTCCGAGCTGCTGTGCAAACAACTTGCGACTTAATGTCCTTGGTGGCCAAGGCC

AAGGAGCTGCATATACAGA ATGTTCACATGTATCTTCCTACAAAGTTATTTCAGCCTTCTCGTCCTTCACTCAACTTACTTGACTCCCCTGAGTCTCCA

CAAGATAGCCAG GTTCCTTCCGTTCATGTAGAAGTGCATCTTCCTAGGGACCAGTCTGGGGAAGTGGACTTCCAGTCATTGGTTTCACAGTTGAAGGAG

ACCTCAAGCTTACAGGAGCAAGCTGATATACTCTACATGCTGTATTCAATGAA AGGACCTGACTGGAACACTGAATTGTATGAAGAAGGGGGGGCTACT

GTCAGAGAGCTTCTTAGTGAACTGTATGTCAAAGTTGGTGAAATTCGGCACTGGGGTCTGATCCGATATATCTCTGGGATCTTACGGAAGAAAGTGGAGG

CACTTGATGAG GCCTGCACAGACCTTCTGTCCTACCAGAAACACCTGACAGTAGGACTTCCTCCAGAACCTCGAGAGAAGACCATCTCTGC GCCTCTA

CCGTACGAGGCACTCACTAAGCTGATAGATGAAGCCAGTGAAGGCGACATGAGCATCTCAACCCTTACACAG GAAATAATGGTCTATCTTGCCATGTAT

ATGAGAACTCAGCCTGGCCTCTTTGCAGAAATGTTCAGACTTCGAATCGGTTTGATCATACAAGTTATGGCAACAGAACTAGCACACTCTCTTCGATGTT

CAG CTGAGGAAGCCACAGAGGGCCTGATGAATCTCAGTCCTTCAGCCATGAAGAACCTCCTGCATCACATTCTCAGTGGCAAAGAGTTTGGAGTGGAAC

GAAGCG TTCGTCCCACTGATTCAAATGTGAGTCCTGCTATTTCCATCCATGAGATTGGTGCTGTTGGAGCAACAAAAACTGAACGAACTGGAATCATGC

AGTTAAAAAGTGAGATAAAGCAG GTGGAATTTCATAGGTTGTCTGTCTCAACTGAGAGTCAG ACTAGTGGTGGTCATCCCTCGGGTGTAGATTTGATG

TCGCCATCCTTTCTG TCCCCTGCAGCCTGTATTGCTGCAAGTAGTGGATCCTTTCCTACGGTGTGTGATCATCAGACATCTAAAGATAGTCGTCAAGGC

CAGTGGCAACGCAGGAGAAGGCTAGATGGAGCACTAAATAGAGTACCAATTGGATTTTATCAAAAAGTATGGAAAATTTTGCAGAAA TGTCATGGGCTT

TCTGTGGAAGGTTTTGTTCTTCCCTCTTCAACCACTAGGGAG ATGACCCCAGGTGAGATTAAATTCTCTGTCCATGTGGAGTCTGTCCTGAATCGTGTC

CCTCAGCCAGAATACCGCCAACTTCTGGTTGAAGCCATCCTTGTTCTCACCATGCTGGCAGATATTGAAATTCATAGCATTGGGAGCATCATTGCTGTGG

AGAAAATAGTTCATATTGCCAACGACTTGTTCCTTCAAGAACAG AAAACCCTCGGCGCAGATGATACCATGTTGGCAAAGGATCCTGCATCTGGCATCT

GTACTCTCCTGTATGACAGTGCACCCAGTGGCAGATTTGGCACCATGACCTACCTCTCCAAGGCAGCTGCCACCTACGTGCAGGAGTTTCTGCCACACAG

CCTCTGTGCCATGCAGTGAGGGCTGTGGGTTCTGCCTGTTAGAACACTTCAGTAGCTAGCCCGTCTGGTTGATTGTGCATGGAACTGACATGTTAACACC

TGATCACTCCCCCAGGCCCTTTTCCTGCCCCATCCCTCCTAGGAAGAGAGAACTTTGCTGACGATCTCACTACTTTTGAAGAAAAGAAGCCCTATCTGGA

GACTTGACTCCAGAGCGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGGTTCAACTGCGCCTGCAGTCACTATCCCTACTTTTGTGGTTCATAGAAG

TCTGCATGTGCGTTGATTCTGTAGAGCTGTTAGTGGCTTAGTTTTTAAACTCCTATTGGGGAGTAGGTATTAATAACTTATTCCTGTAAGTTGGTTTTCT

TATTTGTTGGTTTTTACGTGTGTATATGAGTGGTGGGTATTGATTAGGCCATCATTTCAAGAGAGTAGATGCTAAGTTGGATTTCGTGCTGCTGTAAATT

GGAACTGTCGACTCTAAGTGCCTTTACTTAGGAAAAGCCAGTACCACATCATGGCTTCCTTCTTCACTCAAAGGCTGCTTTGCTCTGAGTGGGGAAAGAG

TGGGTGTTTTGTAGAAGCATTGCCTTTCATTGTTCTTTCTATATCTGTCCACAATGCCTACTGTCTCTGTGGTGAAATATTAAAATATGTAAGCTCACAT

GGAAGTTTAAGAATTTCTGTGTTAATACTTGGAATAACCCAGAGAAAAGAAGCCAGAAGCCTAATTCCAGAGAGGAAGGGAAAGAAGTTCTGTAGGTAGT

GCTTTACACATAGGGGGCCGAGAGAACATCAGAGGCAGGTAGGTTGCTTGTGGACAGCCTTAGACACCAAATCCTTGCCTCTGGAGTGTAGCCACACACA

ACACAGAGAGTAACTGAAGCCTATCTTAAGCAAAGAGAAACCACCCGTCCACTCTGGGGCTGCCCTACTGAATGCCCCTTTCCAGGACCTTGGTATTCCT

TCTCATTCAGTCCCCAGCACATCCGGCTACCCCTAGCTCTCTCCACATTCATTCCTCAAGTCTCTCATTTACATGGTTTGACTTTTTAATTCTAGTACTT

ACAACCTTTAATCTTGGTAACTGTGGCCAAATATCTATTGTTATACATATCTCTGAATGTGCTTGTAAGTGGTTAAATAATTTGTAAGCATTTTTGATCT

GTCTGTCTGTCTCTACATGGATGGACTGAATAAGAATGTAAATAATATTTATTGCAAAGCAAGCCTGGTCATACTTGCTGCTTGAGAAGCTGAGGCAGGA

GGATCATGAATTCAAAGCCAGCCTGGGATACATAGCAAGTTTCAGGGCAGTGTGGGTATGAGGTTGTGTCTCAAAAACATTTGAAAGCATGTTGTGCATG

TGTGAGAGAGTGGCGTGGCTGGTCTCAGGCTGACACTCGAAGGGTAGTAGAAATATCCCTTCTGGCCTATTGTCTGCTTCGCTGTGTAGGTAGCCTGACT

TGACAGAGGTTTCTCCTGGTTTTCCTTGTTTCTACCCAGAGAATTTCCTACTCCCCTTTCCCTCCAAATGTTAAGGGTTTTCTCCCAGAACAGTAATGGG

GCTAAAGGGGCAGTGAGCTCCAAACAGTCACAGAGTGAGGAGTCTTCTGAGCTCCCTGGCTAAGTGCAGCGTGCTAGCAGACAGGCAGGGGATGCAAACG

GCTGCCGGGCCACCTCTCCCCTCTCACAAACCATATAAACACAGGGAGGGGCTTTCTCACCACTTCTGAGGAGACTGTACAGCCCGTTTTGTGCCTGTGT

GTGTGTTCATGGCCTGTAAGTGTACCCCAAGCACTGTGGGCGGGAGCTACCACTTCTTTGAGAACCTCTGCTTTACGGTTGACACTGATGCTTATCTTTC

TCTGGAGTTACGGATTTGCCTGTGGATTTAATGCTCACACCATGCTATTTAATTTTTAAAGTAACTTTTCAGAAAATATTACTGGCGTTTTGTTCATTTT

AAGACTGTTAACATGAAGAAAAGTGTGCTAGAACTTTTTAAAAACACATAATGTCTTGAAGTTAGAATAAACACTAAGAAATGACT
Translation
MRSRSNSGVRLDGYARLVHQTILCHQ NPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQ SVVKLMRGLLHCMIRQ VD

KVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASG GLHIIHSLDEVNFIQNLVFYIEAAYKTA DFGIWERGDKTNQGI

SELNASSVGMAK AALEALDELDLFGVKGGPQSVIHVLADEVQHCQ SILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQ GRY

GCCRFLRDGYKTPKE DPNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQ VQEYREALDAVLIKGKNGVPLLPELYSVPPDR VDEEYQNPH

TVDRVPMGKLPHMWGQSLYILGSLMAE GFLAPGEIDPLNRRFSTVPKPDVVVQV - UNI37593 - VSILAETEEIKAILKDKGIDVETIAEVYPIR

VQPARILSHIYSSLG - UNI37593 - GCNSRMKLSGRPYRLMGVLGTSKLYDIRKTIFTFTPQ - UNI37593 - FIDQQQFYLALDNQMIVEML

RTDLSYLCSRWRMTGQPTITFPISHTMLD DEDGTSLNSSILAALRKMQDGYFGGAR RIQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDD

LDSGNWMDSYDSTSNA ARCGDEVARYLDRLLAHTVPHPKLAPTSRKGGLDRFRAAVQTTCDLMSLVAKAKELHIQN NVHMYLPTKLFQPSRPSLNLLD

SPESPQDSQ VPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYMLYSMK KGPDWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISG

ILRKKVEALDE ACTDLLSYQKHLTVGLPPEPREKTISA APLPYEALTKLIDEASEGDMSISTLTQ EIMVYLAMYMRTQPGLFAEMFRLRIGLIIQVM

ATELAHSLRCSA AEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSV VRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQ VEFHRLSVSTE

SQ TSGGHPSGVDLMSPSFL SPAACIAASSGSFPTVCDHQTSKDSRQGQWQRRRRLDGALNRVPIGFYQKVWKILQK CHGLSVEGFVLPSSTTRE MT

PGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQ KTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM

TYLSKAAATYVQEFLPHSLCAMQ
Transcript ENSMUST00000119229
Sequence
AAGGGAGGCGGCACCCGGGGCGCTGACCCGCTGCTGTCGCCGGCCTTCAGTCTCAGGGCCGCCCCGGTCTCCTTCAGTCAAGCGGAGGATGCCGGTGCGC

CACCCGGGGACCACGGGAGACTGAGTGGAGACGGGGTCTTTGCCGGCCGAAGCCTAGACCGCGGGAGGCTGAGCCGCGGCCTGAAGTGGACTCTGAGGCC

GCCGGAACCAGGTGACGCGCGGGAACCATTGGCCACACGAGCAAGGGAGCGTTTAGAAGGTTTCCGTAGGCCTGGCGTCCGAGCTTCCCGTGTGTGCAGT

GGGGGATTAGGGACGTGGCACCATGAGGAGCCGCAGTAACTCGGGAGTCCGCCTGGACGGCTATGCTCGGCTGGTGCATCAGACCATCCTGTGCCATCAG

 AATCCAGTGACAGGCTTGCTTCCAGCCAGCTATGATCAAAAAGATGCCTGGGTCCGAGATAATGTGTACAGTATCCTGGCTGTGTGGGGTTTGGGCCTG

GCATATCGCAAAAATGCTGACCGTGATGAGGACAAGGCAAAGGCCTATGAACTGGAGCAG AGTGTAGTGAAGTTAATGAGGGGACTGCTGCACTGCATG

ATCAGACAG GTGGATAAAGTAGAGTCCTTCAAGTACAGTCAGAGTACTAAAGATAGCCTCCATGCCAAGTACAACACCAAAACTTGTGCCACTGTGGTG

GGTGATGACCAGTGGGGACACCTGCAGTTGGATGCTACTTCTGTGTACCTGCTCTTCCTAGCACAAATGACTGCCTCAG GACTCCATATCATCCACAGC

CTAGACGAAGTCAATTTTATACAGAACCTCGTGTTTTACATTGAAGCTGCATATAAAACTGCT GACTTTGGGATATGGGAACGTGGCGATAAGACAAAC

CAAGGCATCTCGGAATTGAATGCGAGTTCAGTTGGAATGGCCAAG GCAGCCCTGGAAGCACTAGATGAATTAGACTTGTTTGGTGTGAAAGGTGGGCCA

CAATCAGTTATCCATGTCCTGGCTGATGAAGTCCAACACTGCCAG TCTATCCTGAATTCACTACTGCCCAGGGCTTCAACATCCAAAGAAGTTGATGCC

AGTCTGCTCTCAGTGGTCTCTTTCCCAGCCTTTGCTGTAGAGGACAGCCATTTGGTGGAGCTCACCAAACAGGAGATCATCACCAAGCTTCAG GGTCGT

TATGGTTGCTGTCGTTTTCTGCGAGATGGATATAAAACTCCTAAAGAG GATCCCAATCGCCTATACTATGAACCAGCTGAGCTGAAGCTATTTGAAAAC

ATTGAGTGCGAATGGCCATTGTTCTGGACATACTTTATCCTTGATGGGATCTTCAGTGGCAACGTAGAACAG GTTCAAGAATATAGAGAGGCTCTTGAT

GCAGTCCTCATCAAGGGCAAAAATGGAGTCCCTCTTCTTCCAGAGCTGTACAGTGTCCCTCCTGACAGG GTTGATGAAGAGTATCAAAATCCCCACACT

GTGGATCGAGTCCCTATGGGAAAATTGCCTCACATGTGGGGTCAGTCTCTATACATTTTAGGAAGCTTGATGGCAGAG GGATTTTTAGCTCCTGGAGAA

ATTGATCCCCTGAATCGTAGGTTTTCTACTGTGCCAAAGCCAGATGTGGTGGTTCAAG - UNI37593 - TCTCCATTCTGGCTGAAACAGAAGAAAT

CAAGGCCATTTTGAAGGACAAAGGAATTGATGTGGAGACCATTGCTGAAGTGTACCCCATAAGAGTACAGCCAGCTCGTATTCTCAGCCATATTTATTCT

AGTCTAG - UNI37593 - GATGCAACAGTAGAATGAAACTCAGTGGACGACCCTACAGGCTCATGGGTGTGCTTGGAACATCAAAACTTTATGACAT

TCGCAAAACTATCTTTACTTTCACTCCACAG - UNI37593 - TTTATAGACCAGCAACAGTTCTACCTGGCTCTGGACAACCAGATGATAGTAGAAA

TGCTCAGAACAGACCTTTCCTACCTCTGTAGCCGCTGGAGGATGACAGGCCAGCCCACGATCACTTTCCCTATCTCGCACACCATGCTTG ATGAAGATG

GAACCAGCTTGAATTCAAGTATCTTGGCAGCACTCCGAAAAATGCAGGATGGCTATTTTGGTGGGGCCAG GATCCAAACAGGTAAATTGTCAGAGTTTT

TGACAACATCTTGCTGCACACACTTAAGCTTCATGGACCCTGGACCTGAGGGTAAGCTGTACAGTGAAGATTATGATGAAGACTATGAAGATGATTTGGA

CTCTGGCAACTGGATGGACAGCTATGATTCAACAAGTAATG CTCGCTGTGGTGATGAAGTTGCCCGTTATTTAGACCGCCTTTTGGCACACACTGTTCC

CCATCCTAAACTAGCTCCTACCTCACGGAAGGGAGGGCTAGATCGGTTCCGAGCTGCTGTGCAAACAACTTGCGACTTAATGTCCTTGGTGGCCAAGGCC

AAGGAGCTGCATATACAGA ATGTTCACATGTATCTTCCTACAAAGTTATTTCAGCCTTCTCGTCCTTCACTCAACTTACTTGACTCCCCTGAGTCTCCA

CAAGATAGCCAG GTTCCTTCCGTTCATGTAGAAGTGCATCTTCCTAGGGACCAGTCTGGGGAAGTGGACTTCCAGTCATTGGTTTCACAGTTGAAGGAG

ACCTCAAGCTTACAGGAGCAAGCTGATATACTCTACATGCTGTATTCAATGAA AGGACCTGACTGGAACACTGAATTGTATGAAGAAGGGGGGGCTACT

GTCAGAGAGCTTCTTAGTGAACTGTATGTCAAAGTTGGTGAAATTCGGCACTGGGGTCTGATCCGATATATCTCTGGGATCTTACGGAAGAAAGTGGAGG

CACTTGATGAG GCCTGCACAGACCTTCTGTCCTACCAGAAACACCTGACAGTAGGACTTCCTCCAGAACCTCGAGAGAAGACCATCTCTGC GCCTCTA

CCGTACGAGGCACTCACTAAGCTGATAGATGAAGCCAGTGAAGGCGACATGAGCATCTCAACCCTTACACAG GAAATAATGGTCTATCTTGCCATGTAT

ATGAGAACTCAGCCTGGCCTCTTTGCAGAAATGTTCAGACTTCGAATCGGTTTGATCATACAAGTTATGGCAACAGAACTAGCACACTCTCTTCGATGTT

CAG CTGAGGAAGCCACAGAGGGCCTGATGAATCTCAGTCCTTCAGCCATGAAGAACCTCCTGCATCACATTCTCAGTGGCAAAGAGTTTGGAGTGGAAC

GAAGCG TTCGTCCCACTGATTCAAATGTGAGTCCTGCTATTTCCATCCATGAGATTGGTGCTGTTGGAGCAACAAAAACTGAACGAACTGGAATCATGC

AGTTAAAAAGTGAGATAAAGCAG TCCCCTGCAGCCTGTATTGCTGCAAGTAGTGGATCCTTTCCTACGGTGTGTGATCATCAGACATCTAAAGATAGTC

GTCAAGGCCAGTGGCAACGCAGGAGAAGGCTAGATGGAGCACTAAATAGAGTACCAATTGGATTTTATCAAAAAGTATGGAAAATTTTGCAGAAA TGTC

ATGGGCTTTCTGTGGAAGGTTTTGTTCTTCCCTCTTCAACCACTAGGGAG ATGACCCCAGGTGAGATTAAATTCTCTGTCCATGTGGAGTCTGTCCTGA

ATCGTGTCCCTCAGCCAGAATACCGCCAACTTCTGGTTGAAGCCATCCTTGTTCTCACCATGCTGGCAGATATTGAAATTCATAGCATTGGGAGCATCAT

TGCTGTGGAGAAAATAGTTCATATTGCCAACGACTTGTTCCTTCAAGAACAG AAAACCCTCGGCGCAGATGATACCATGTTGGCAAAGGATCCTGCATC

TGGCATCTGTACTCTCCTGTATGACAGTGCACCCAGTGGCAGATTTGGCACCATGACCTACCTCTCCAAGGCAGCTGCCACCTACGTGCAGGAGTTTCTG

CCACACAGCCTCTGTGCCATGCAGTGAGGGCTGTGGGTTCTGCCTGTTAGAACACTTCAGTAGCTAGCCCGTCTGGTTGATTGTGCATGGAACTGACATG

TTAACACCTGATCACTCCCCCAGGCCCTTTTCCTGCCCCATCCCTCCTAGGAAGAGAGAACTTTGCTGACGATCTCACTACTTTTGAAGAAAAGAAGCCC

TATCTGGAGACTTGACTCCAGAGCGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGGTTCAACTGCGCCTGCAGTCACTATCCCTACTTTTGTGGTT

CATAGAAGTCTGCATGTGCGTTGATTCTGTAGAGCTGTTAGTGGCTTAGTTTTTAAACTCCTATTGGGGAGTAGGTATTAATAACTTATTCCTGTAAGTT

GGTTTTCTTATTTGTTGGTTTTTACGTGTGTATATGAGTGGTGGGTATTGATTAGGCCATCATTTCAAGAGAGTAGATGCTAAGTTGGATTTCGTGCTGC

TGTAAATTGGAACTGTCGACTCTAAGTGCCTTTACTTAGGAAAAGCCAGTACCACATCATGGCTTCCTTCTTCACTCAAAGGCTGCTTTGCTCTGAGTGG

GGAAAGAGTGGGTGTTTTGTAGAAGCATTGCCTTTCATTGTTCTTTCTATATCTGTCCACAATGCCTACTGTCTCTGTGGTGAAATATTAAAATATGTAA

GCTCACATGGAAGTTTAAGAATTTCTGTGTTAATACTTGGAATAACCCAGAGAAAAGAAGCCAGAAGCCTAATTCCAGAGAGGAAGGGAAAGAAGTTCTG

TAGGTAGTGCTTTACACATAGGGGGCCGAGAGAACATCAGAGGCAGGTAGGTTGCTTGTGGACAGCCTTAGACACCAAATCCTTGCCTCTGGAGTGTAGC

CACACACAACACAGAGAGTAACTGAAGCCTATCTTAAGCAAAGAGAAACCACCCGTCCACTCTGGGGCTGCCCTACTGAATGCCCCTTTCCAGGACCTTG

GTATTCCTTCTCATTCAGTCCCCAGCACATCCGGCTACCCCTAGCTCTCTCCACATTCATTCCTCAAGTCTCTCATTTACATGGTTTGACTTTTTAATTC

TAGTACTTACAACCTTTAATCTTGGTAACTGTGGCCAAATATCTATTGTTATACATATCTCTGAATGTGCTTGTAAGTGGTTAAATAATTTGTAAGCATT

TTTGATCTGTCTGTCTGTCTCTACATGGATGGACTGAATAAGAATGTAAATAATATTTATTGCAAAGCAAGCCTGGTCATACTTGCTGCTTGAGAAGCTG

AGGCAGGAGGATCATGAATTCAAAGCCAGCCTGGGATACATAGCAAGTTTCAGGGCAGTGTGGGTATGAGGTTGTGTCTCAAAAACATTTGAAAGCATGT

TGTGCATGTGTGAGAGAGTGGCGTGGCTGGTCTCAGGCTGACACTCGAAGGGTAGTAGAAATATCCCTTCTGGCCTATTGTCTGCTTCGCTGTGTAGGTA

GCCTGACTTGACAGAGGTTTCTCCTGGTTTTCCTTGTTTCTACCCAGAGAATTTCCTACTCCCCTTTCCCTCCAAATGTTAAGGGTTTTCTCCCAGAACA

GTAATGGGGCTAAAGGGGCAGTGAGCTCCAAACAGTCACAGAGTGAGGAGTCTTCTGAGCTCCCTGGCTAAGTGCAGCGTGCTAGCAGACAGGCAGGGGA

TGCAAACGGCTGCCGGGCCACCTCTCCCCTCTCACAAACCATATAAACACAGGGAGGGGCTTTCTCACCACTTCTGAGGAGACTGTACAGCCCGTTTTGT

GCCTGTGTGTGTGTTCATGGCCTGTAAGTGTACCCCAAGCACTGTGGGCGGGAGCTACCACTTCTTTGAGAACCTCTGCTTTACGGTTGACACTGATGCT

TATCTTTCTCTGGAGTTACGGATTTGCCTGTGGATTTAATGCTCACACCATGCTATTTAATTTTTAAAGTAACTTTTCAGAAAATATTACTGGCGTTTTG

TTCATTTTAAGACTGTTAACATGAAGAAAAGTGTGCTAGAACTTTTTAAAAACACATAATGTCTTGAAGTTAGAATAAACACTAAGAAATGACT
Translation
MRSRSNSGVRLDGYARLVHQTILCHQ NPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQ SVVKLMRGLLHCMIRQ VD

KVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASG GLHIIHSLDEVNFIQNLVFYIEAAYKTA DFGIWERGDKTNQGI

SELNASSVGMAK AALEALDELDLFGVKGGPQSVIHVLADEVQHCQ SILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQ GRY

GCCRFLRDGYKTPKE DPNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQ VQEYREALDAVLIKGKNGVPLLPELYSVPPDR VDEEYQNPH

TVDRVPMGKLPHMWGQSLYILGSLMAE GFLAPGEIDPLNRRFSTVPKPDVVVQV - UNI37593 - VSILAETEEIKAILKDKGIDVETIAEVYPIR

VQPARILSHIYSSLG - UNI37593 - GCNSRMKLSGRPYRLMGVLGTSKLYDIRKTIFTFTPQ - UNI37593 - FIDQQQFYLALDNQMIVEML

RTDLSYLCSRWRMTGQPTITFPISHTMLD DEDGTSLNSSILAALRKMQDGYFGGAR RIQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDD

LDSGNWMDSYDSTSNA ARCGDEVARYLDRLLAHTVPHPKLAPTSRKGGLDRFRAAVQTTCDLMSLVAKAKELHIQN NVHMYLPTKLFQPSRPSLNLLD

SPESPQDSQ VPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYMLYSMK KGPDWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISG

ILRKKVEALDE ACTDLLSYQKHLTVGLPPEPREKTISA APLPYEALTKLIDEASEGDMSISTLTQ EIMVYLAMYMRTQPGLFAEMFRLRIGLIIQVM

ATELAHSLRCSA AEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSV VRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQ SPAACIAASSG

SFPTVCDHQTSKDSRQGQWQRRRRLDGALNRVPIGFYQKVWKILQK CHGLSVEGFVLPSSTTRE MTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILV

LTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQ KTLGADDTMLAKDPASGICTLLYDSAPSGRFGTMTYLSKAAATYVQEFLPHSLCAMQ
Transcript ENSMUST00000113611
Sequence
CCCGGTCTCCTTCAGTCAAGCGGAGGATGCCGGTGCGCCACCCGGGGACCACGGGAGACTGAGTGGAGACGGGGTCTTTGCCGGCCGAAGCCTAGACCGC

GGGAGGCTGAGCCGCGGCCTGAAGTGGACTCTGAGGCCGCCGGAACCAGGTGACGCGCGGGAACCATTGGCCACACGAGCAAGGGAGCGTTTAGAAGGTT

TCCGTAGGCCTGGCGTCCGAGCTTCCCGTGTGTGCAGTGGGGGATTAGGGACGTGGCACCATGAGGAGCCGCAGTAACTCGGGAGTCCGCCTGGACGGCT

ATGCTCGGCTGGTGCATCAGACCATCCTGTGCCATCAG AATCCAGTGACAGGCTTGCTTCCAGCCAGCTATGATCAAAAAGATGCCTGGGTCCGAGATA

ATGTGTACAGTATCCTGGCTGTGTGGGGTTTGGGCCTGGCATATCGCAAAAATGCTGACCGTGATGAGGACAAGGCAAAGGCCTATGAACTGGAGCAG A

GTGTAGTGAAGTTAATGAGGGGACTGCTGCACTGCATGATCAGACAG GTGGATAAAGTAGAGTCCTTCAAGTACAGTCAGAGTACTAAAGATAGCCTCC

ATGCCAAGTACAACACCAAAACTTGTGCCACTGTGGTGGGTGATGACCAGTGGGGACACCTGCAGTTGGATGCTACTTCTGTGTACCTGCTCTTCCTAGC

ACAAATGACTGCCTCAG GACTCCATATCATCCACAGCCTAGACGAAGTCAATTTTATACAGAACCTCGTGTTTTACATTGAAGCTGCATATAAAACTGC

T GACTTTGGGATATGGGAACGTGGCGATAAGACAAACCAAGGCATCTCGGAATTGAATGCGAGTTCAGTTGGAATGGCCAAG GCAGCCCTGGAAGCAC

TAGATGAATTAGACTTGTTTGGTGTGAAAGGTGGGCCACAATCAGTTATCCATGTCCTGGCTGATGAAGTCCAACACTGCCAG TCTATCCTGAATTCAC

TACTGCCCAGGGCTTCAACATCCAAAGAAGTTGATGCCAGTCTGCTCTCAGTGGTCTCTTTCCCAGCCTTTGCTGTAGAGGACAGCCATTTGGTGGAGCT

CACCAAACAGGAGATCATCACCAAGCTTCAG GGTCGTTATGGTTGCTGTCGTTTTCTGCGAGATGGATATAAAACTCCTAAAGAG GATCCCAATCGCC

TATACTATGAACCAGCTGAGCTGAAGCTATTTGAAAACATTGAGTGCGAATGGCCATTGTTCTGGACATACTTTATCCTTGATGGGATCTTCAGTGGCAA

CGTAGAACAG GTTCAAGAATATAGAGAGGCTCTTGATGCAGTCCTCATCAAGGGCAAAAATGGAGTCCCTCTTCTTCCAGAGCTGTACAGTGTCCCTCC

TGACAGG GTTGATGAAGAGTATCAAAATCCCCACACTGTGGATCGAGTCCCTATGGGAAAATTGCCTCACATGTGGGGTCAGTCTCTATACATTTTAGG

AAGCTTGATGGCAGAG GGATTTTTAGCTCCTGGAGAAATTGATCCCCTGAATCGTAGGTTTTCTACTGTGCCAAAGCCAGATGTGGTGGTTCAAG - U

NI37593 - TCTCCATTCTGGCTGAAACAGAAGAAATCAAGGCCATTTTGAAGGACAAAGGAATTGATGTGGAGACCATTGCTGAAGTGTACCCCATAA

GAGTACAGCCAGCTCGTATTCTCAGCCATATTTATTCTAGTCTAG - UNI37593 - GATGCAACAGTAGAATGAAACTCAGTGGACGACCCTACAGG

CTCATGGGTGTGCTTGGAACATCAAAACTTTATGACATTCGCAAAACTATCTTTACTTTCACTCCACAG - UNI37593 - TTTATAGACCAGCAACA

GTTCTACCTGGCTCTGGACAACCAGATGATAGTAGAAATGCTCAGAACAGACCTTTCCTACCTCTGTAGCCGCTGGAGGATGACAGGCCAGCCCACGATC

ACTTTCCCTATCTCGCACACCATGCTTG ATGAAGATGGAACCAGCTTGAATTCAAGTATCTTGGCAGCACTCCGAAAAATGCAGGATGGCTATTTTGGT

GGGGCCAG GATCCAAACAGGTAAATTGTCAGAGTTTTTGACAACATCTTGCTGCACACACTTAAGCTTCATGGACCCTGGACCTGAGGGTAAGCTGTAC

AGTGAAGATTATGATGAAGACTATGAAGATGATTTGGACTCTGGCAACTGGATGGACAGCTATGATTCAACAAGTAATG CTCGCTGTGGTGATGAAGTT

GCCCGTTATTTAGACCGCCTTTTGGCACACACTGTTCCCCATCCTAAACTAGCTCCTACCTCACGGAAGGGAGGGCTAGATCGGTTCCGAGCTGCTGTGC

AAACAACTTGCGACTTAATGTCCTTGGTGGCCAAGGCCAAGGAGCTGCATATACAGA ATGTTCACATGTATCTTCCTACAAAGTTATTTCAGCCTTCTC

GTCCTTCACTCAACTTACTTGACTCCCCTGAGTCTCCACAAGATAGCCAG GTTCCTTCCGTTCATGTAGAAGTGCATCTTCCTAGGGACCAGTCTGGGG

AAGTGGACTTCCAGTCATTGGTTTCACAGTTGAAGGAGACCTCAAGCTTACAGGAGCAAGCTGATATACTCTACATGCTGTATTCAATGAA AGGACCTG

ACTGGAACACTGAATTGTATGAAGAAGGGGGGGCTACTGTCAGAGAGCTTCTTAGTGAACTGTATGTCAAAGTTGGTGAAATTCGGCACTGGGGTCTGAT

CCGATATATCTCTGGGATCTTACGGAAGAAAGTGGAGGCACTTGATGAG GCCTGCACAGACCTTCTGTCCTACCAGAAACACCTGACAGTAGGACTTCC

TCCAGAACCTCGAGAGAAGACCATCTCTGC GCCTCTACCGTACGAGGCACTCACTAAGCTGATAGATGAAGCCAGTGAAGGCGACATGAGCATCTCAAC

CCTTACACAG GAAATAATGGTCTATCTTGCCATGTATATGAGAACTCAGCCTGGCCTCTTTGCAGAAATGTTCAGACTTCGAATCGGTTTGATCATACA

AGTTATGGCAACAGAACTAGCACACTCTCTTCGATGTTCAG CTGAGGAAGCCACAGAGGGCCTGATGAATCTCAGTCCTTCAGCCATGAAGAACCTCCT

GCATCACATTCTCAGTGGCAAAGAGTTTGGAGTGGAACGAAGCG TTCGTCCCACTGATTCAAATGTGAGTCCTGCTATTTCCATCCATGAGATTGGTGC

TGTTGGAGCAACAAAAACTGAACGAACTGGAATCATGCAGTTAAAAAGTGAGATAAAGCAG GTGGAATTTCGTAGGCTGTCTGTCTCGATGGAGAGTCA

G TCCCCTGCAGCCTGTATTGCTGCAAGTAGTGGATCCTTTCCTACGGTGTGTGATCATCAGACATCTAAAGATAGTCGTCAAGGCCAGTGGCAACGCAG

GAGAAGGCTAGATGGAGCACTAAATAGAGTACCAATTGGATTTTATCAAAAAGTATGGAAAATTTTGCAGAAA TGTCATGGGCTTTCTGTGGAAGGTTT

TGTTCTTCCCTCTTCAACCACTAGGGAG ATGACCCCAGGTGAGATTAAATTCTCTGTCCATGTGGAGTCTGTCCTGAATCGTGTCCCTCAGCCAGAATA

CCGCCAACTTCTGGTTGAAGCCATCCTTGTTCTCACCATGCTGGCAGATATTGAAATTCATAGCATTGGGAGCATCATTGCTGTGGAGAAAATAGTTCAT

ATTGCCAACGACTTGTTCCTTCAAGAACAG AAAACCCTCGGCGCAGATGATACCATGTTGGCAAAGGATCCTGCATCTGGCATCTGTACTCTCCTGTAT

GACAGTGCACCCAGTGGCAGATTTGGCACCATGACCTACCTCTCCAAGGCAGCTGCCACCTACGTGCAGGAGTTTCTGCCACACAGCCTCTGTGCCATGC

AGTGAGGGCTGTGGGTTCTGCCTGTTAGAACACTTCAGTAGCTAGCCCGTCTGGTTGATTGTGCATGGAACTGACATGTTAACACCTGATCACTCCCCCA

GGCCCTTTTCCTGCCCCATCCCTCCTAGGAAGAGAGAACTTTGCTGACGATCTCACTACTTTTGAAGAAAAGAAGCCCTATCTGGAGACTTGACTCCAGA

GCGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGGTTCAACTGCGCCTGCAGTCACTATCCCTACTTTTGTGGTTCATAGAAGTCTGCATGTGCGTT

GATTCTGTAGAGCTGTTAGTGGCTTAGTTTTTAAACTCCTATTGGGGAGTAGGTATTAATAACTTATTCCTGTAAGTTGGTTTTCTTATTTGTTGGTTTT

TACGTGTGTATATGAGTGGTGGGTATTGATTAGGCCATCATTTCAAGAGAGTAGATGCTAAGTTGGATTTCGTGCTGCTGTAAATTGGAACTGTCGACTC

TAAGTGCCTTTACTTAGGAAAAGCCAGTACCACATCATGGCTTCCTTCTTCACTCAAAGGCTGCTTTGCTCTGAGTGGGGAAAGAGTGGGTGTTTTGTAG

AAGCATTGCCTTTCATTGTTCTTTCTATATCTGTCCACAATGCCTACTGTCTCTGTGGTGAAATATTAAAATATGTAAGCTC
Translation
MRSRSNSGVRLDGYARLVHQTILCHQ NPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQ SVVKLMRGLLHCMIRQ VD

KVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASG GLHIIHSLDEVNFIQNLVFYIEAAYKTA DFGIWERGDKTNQGI

SELNASSVGMAK AALEALDELDLFGVKGGPQSVIHVLADEVQHCQ SILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQ GRY

GCCRFLRDGYKTPKE DPNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQ VQEYREALDAVLIKGKNGVPLLPELYSVPPDR VDEEYQNPH

TVDRVPMGKLPHMWGQSLYILGSLMAE GFLAPGEIDPLNRRFSTVPKPDVVVQV - UNI37593 - VSILAETEEIKAILKDKGIDVETIAEVYPIR

VQPARILSHIYSSLG - UNI37593 - GCNSRMKLSGRPYRLMGVLGTSKLYDIRKTIFTFTPQ - UNI37593 - FIDQQQFYLALDNQMIVEML

RTDLSYLCSRWRMTGQPTITFPISHTMLD DEDGTSLNSSILAALRKMQDGYFGGAR RIQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDD

LDSGNWMDSYDSTSNA ARCGDEVARYLDRLLAHTVPHPKLAPTSRKGGLDRFRAAVQTTCDLMSLVAKAKELHIQN NVHMYLPTKLFQPSRPSLNLLD

SPESPQDSQ VPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYMLYSMK KGPDWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISG

ILRKKVEALDE ACTDLLSYQKHLTVGLPPEPREKTISA APLPYEALTKLIDEASEGDMSISTLTQ EIMVYLAMYMRTQPGLFAEMFRLRIGLIIQVM

ATELAHSLRCSA AEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSV VRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQ VEFRRLSVSME

SQ SPAACIAASSGSFPTVCDHQTSKDSRQGQWQRRRRLDGALNRVPIGFYQKVWKILQK CHGLSVEGFVLPSSTTRE MTPGEIKFSVHVESVLNRVP

QPEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQ KTLGADDTMLAKDPASGICTLLYDSAPSGRFGTMTYLSKAAATYVQEFLPHS

LCAMQ
Transcript ENSMUST00000043596
Sequence
CCCGGTCTCCTTCAGTCAAGCGGAGGATGCCGGTGCGCCACCCGGGGACCACGGGAGACTGAGTGGAGACGGGGTCTTTGCCGGCCGAAGCCTAGACCGC

GGGAGGCTGAGCCGCGGCCTGAAGTGGACTCTGAGGCCGCCGGAACCAGGTGACGCGCGGGAACCATTGGCCACACGAGCAAGGGAGCGTTTAGAAGGTT

TCCGTAGGCCTGGCGTCCGAGCTTCCCGTGTGTGCAGTGGGGGATTAGGGACGTGGCACCATGAGGAGCCGCAGTAACTCGGGAGTCCGCCTGGACGGCT

ATGCTCGGCTGGTGCATCAGACCATCCTGTGCCATCAG AATCCAGTGACAGGCTTGCTTCCAGCCAGCTATGATCAAAAAGATGCCTGGGTCCGAGATA

ATGTGTACAGTATCCTGGCTGTGTGGGGTTTGGGCCTGGCATATCGCAAAAATGCTGACCGTGATGAGGACAAGGCAAAGGCCTATGAACTGGAGCAG A

GTGTAGTGAAGTTAATGAGGGGACTGCTGCACTGCATGATCAGACAG GTGGATAAAGTAGAGTCCTTCAAGTACAGTCAGAGTACTAAAGATAGCCTCC

ATGCCAAGTACAACACCAAAACTTGTGCCACTGTGGTGGGTGATGACCAGTGGGGACACCTGCAGTTGGATGCTACTTCTGTGTACCTGCTCTTCCTAGC

ACAAATGACTGCCTCAG GACTCCATATCATCCACAGCCTAGACGAAGTCAATTTTATACAGAACCTCGTGTTTTACATTGAAGCTGCATATAAAACTGC

T GACTTTGGGATATGGGAACGTGGCGATAAGACAAACCAAGGCATCTCGGAATTGAATGCGAGTTCAGTTGGAATGGCCAAG GCAGCCCTGGAAGCAC

TAGATGAATTAGACTTGTTTGGTGTGAAAGGTGGGCCACAATCAGTTATCCATGTCCTGGCTGATGAAGTCCAACACTGCCAG TCTATCCTGAATTCAC

TACTGCCCAGGGCTTCAACATCCAAAGAAGTTGATGCCAGTCTGCTCTCAGTGGTCTCTTTCCCAGCCTTTGCTGTAGAGGACAGCCATTTGGTGGAGCT

CACCAAACAGGAGATCATCACCAAGCTTCAG GGTCGTTATGGTTGCTGTCGTTTTCTGCGAGATGGATATAAAACTCCTAAAGAG GATCCCAATCGCC

TATACTATGAACCAGCTGAGCTGAAGCTATTTGAAAACATTGAGTGCGAATGGCCATTGTTCTGGACATACTTTATCCTTGATGGGATCTTCAGTGGCAA

CGTAGAACAG GTTCAAGAATATAGAGAGGCTCTTGATGCAGTCCTCATCAAGGGCAAAAATGGAGTCCCTCTTCTTCCAGAGCTGTACAGTGTCCCTCC

TGACAGG GTTGATGAAGAGTATCAAAATCCCCACACTGTGGATCGAGTCCCTATGGGAAAATTGCCTCACATGTGGGGTCAGTCTCTATACATTTTAGG

AAGCTTGATGGCAGAG GGATTTTTAGCTCCTGGAGAAATTGATCCCCTGAATCGTAGGTTTTCTACTGTGCCAAAGCCAGATGTGGTGGTTCAAG - U

NI37593 - TCTCCATTCTGGCTGAAACAGAAGAAATCAAGGCCATTTTGAAGGACAAAGGAATTGATGTGGAGACCATTGCTGAAGTGTACCCCATAA

GAGTACAGCCAGCTCGTATTCTCAGCCATATTTATTCTAGTCTAG - UNI37593 - GATGCAACAGTAGAATGAAACTCAGTGGACGACCCTACAGG

CTCATGGGTGTGCTTGGAACATCAAAACTTTATGACATTCGCAAAACTATCTTTACTTTCACTCCACAG - UNI37593 - TTTATAGACCAGCAACA

GTTCTACCTGGCTCTGGACAACCAGATGATAGTAGAAATGCTCAGAACAGACCTTTCCTACCTCTGTAGCCGCTGGAGGATGACAGGCCAGCCCACGATC

ACTTTCCCTATCTCGCACACCATGCTTG ATGAAGATGGAACCAGCTTGAATTCAAGTATCTTGGCAGCACTCCGAAAAATGCAGGATGGCTATTTTGGT

GGGGCCAG GATCCAAACAGGTAAATTGTCAGAGTTTTTGACAACATCTTGCTGCACACACTTAAGCTTCATGGACCCTGGACCTGAGGGTAAGCTGTAC

AGTGAAGATTATGATGAAGACTATGAAGATGATTTGGACTCTGGCAACTGGATGGACAGCTATGATTCAACAAGTAATG ATGTTCACATGTATCTTCCT

ACAAAGTTATTTCAGCCTTCTCGTCCTTCACTCAACTTACTTGACTCCCCTGAGTCTCCACAAGATAGCCAG GTTCCTTCCGTTCATGTAGAAGTGCAT

CTTCCTAGGGACCAGTCTGGGGAAGTGGACTTCCAGTCATTGGTTTCACAGTTGAAGGAGACCTCAAGCTTACAGGAGCAAGCTGATATACTCTACATGC

TGTATTCAATGAA AGGACCTGACTGGAACACTGAATTGTATGAAGAAGGGGGGGCTACTGTCAGAGAGCTTCTTAGTGAACTGTATGTCAAAGTTGGTG

AAATTCGGCACTGGGGTCTGATCCGATATATCTCTGGGATCTTACGGAAGAAAGTGGAGGCACTTGATGAG GCCTGCACAGACCTTCTGTCCTACCAGA

AACACCTGACAGTAGGACTTCCTCCAGAACCTCGAGAGAAGACCATCTCTGC GCCTCTACCGTACGAGGCACTCACTAAGCTGATAGATGAAGCCAGTG

AAGGCGACATGAGCATCTCAACCCTTACACAG GAAATAATGGTCTATCTTGCCATGTATATGAGAACTCAGCCTGGCCTCTTTGCAGAAATGTTCAGAC

TTCGAATCGGTTTGATCATACAAGTTATGGCAACAGAACTAGCACACTCTCTTCGATGTTCAG CTGAGGAAGCCACAGAGGGCCTGATGAATCTCAGTC

CTTCAGCCATGAAGAACCTCCTGCATCACATTCTCAGTGGCAAAGAGTTTGGAGTGGAACGAAGCG TTCGTCCCACTGATTCAAATGTGAGTCCTGCTA

TTTCCATCCATGAGATTGGTGCTGTTGGAGCAACAAAAACTGAACGAACTGGAATCATGCAGTTAAAAAGTGAGATAAAGCAG GTGGAATTTCGTAGGC

TGTCTGTCTCGATGGAGAGTCAG ACTAGTGGTGGTCATCCCTCGGGTGTAGATTTGATGTCGCCATCCTTTCTG TCCCCTGCAGCCTGTATTGCTGCA

AGTAGTGGATCCTTTCCTACGGTGTGTGATCATCAGACATCTAAAGATAGTCGTCAAGGCCAGTGGCAACGCAGGAGAAGGCTAGATGGAGCACTAAATA

GAGTACCAATTGGATTTTATCAAAAAGTATGGAAAATTTTGCAGAAA TGTCATGGGCTTTCTGTGGAAGGTTTTGTTCTTCCCTCTTCAACCACTAGGG

AG ATGACCCCAGGTGAGATTAAATTCTCTGTCCATGTGGAGTCTGTCCTGAATCGTGTCCCTCAGCCAGAATACCGCCAACTTCTGGTTGAAGCCATCC

TTGTTCTCACCATGCTGGCAGATATTGAAATTCATAGCATTGGGAGCATCATTGCTGTGGAGAAAATAGTTCATATTGCCAACGACTTGTTCCTTCAAGA

ACAG AAAACCCTCGGCGCAGATGATACCATGTTGGCAAAGGATCCTGCATCTGGCATCTGTACTCTCCTGTATGACAGTGCACCCAGTGGCAGATTTGG

CACCATGACCTACCTCTCCAAGGCAGCTGCCACCTACGTGCAGGAGTTTCTGCCACACAGCCTCTGTGCCATGCAGTGAGGGCTGTGGGTTCTGCCTGTT

AGAACACTTCAGTAGCTAGCCCGTCTGGTTGATTGTGCATGGAACTGACATGTTAACACCTGATCACTCCCCCAGGCCCTTTTCCTGCCCCATCCCTCCT

AGGAAGAGAGAACTTTGCTGACGATCTCACTACTTTTGAAGAAAAGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGCCCTATCTGGAGACTTGACT

CCAGAGCGAAGGTTCAACTGCGCCTGCAGTCACTATCCCTACTTTTGTGGTTCATAGAAGTCTGCATGTGCGTTGATTCTGTAGAGCTGTTAGTGGCTTA

GTTTTTAAACTCCTATTGGGGAGTAGGTATTAATAACTTATTCCTGTAAGTTGGTTTTCTTATTTGTTGGTTTTTACGTGTGTATATGAGTGGTGGGTAT

TGATTAGGCCATCATTTCAAGAGAGTAGATGCTAAGTTGGATTTCGTGCTGCTGTAAATTGGAACTGTCGACTCTAAGTGCCTTTACTTAGGAAAAGCCA

GTACCACATCATGGCTTCCTTCTTCACTCAAAGGCTGCTTTGCTCTGAGTGGGGAAAGAGTGGGTGTTTTGTAGAAGCATTGCCTTTCATTGTTCTTTCT

ATATCTGTCCACAATGCCTACTGTCTCTGTGGTGAAATATTAAAATATGTAAGCTC
Translation
MRSRSNSGVRLDGYARLVHQTILCHQ NPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQ SVVKLMRGLLHCMIRQ VD

KVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASG GLHIIHSLDEVNFIQNLVFYIEAAYKTA DFGIWERGDKTNQGI

SELNASSVGMAK AALEALDELDLFGVKGGPQSVIHVLADEVQHCQ SILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQ GRY

GCCRFLRDGYKTPKE DPNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQ VQEYREALDAVLIKGKNGVPLLPELYSVPPDR VDEEYQNPH

TVDRVPMGKLPHMWGQSLYILGSLMAE GFLAPGEIDPLNRRFSTVPKPDVVVQV - UNI37593 - VSILAETEEIKAILKDKGIDVETIAEVYPIR

VQPARILSHIYSSLG - UNI37593 - GCNSRMKLSGRPYRLMGVLGTSKLYDIRKTIFTFTPQ - UNI37593 - FIDQQQFYLALDNQMIVEML

RTDLSYLCSRWRMTGQPTITFPISHTMLD DEDGTSLNSSILAALRKMQDGYFGGAR RIQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDD

LDSGNWMDSYDSTSND DVHMYLPTKLFQPSRPSLNLLDSPESPQDSQ VPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYMLYSMK KGP

DWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISGILRKKVEALDE ACTDLLSYQKHLTVGLPPEPREKTISA APLPYEALTKLIDEASEGDMS

ISTLTQ EIMVYLAMYMRTQPGLFAEMFRLRIGLIIQVMATELAHSLRCSA AEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSV VRPTDSNVSPAI

SIHEIGAVGATKTERTGIMQLKSEIKQ VEFRRLSVSMESQ TSGGHPSGVDLMSPSFL SPAACIAASSGSFPTVCDHQTSKDSRQGQWQRRRRLDGAL

NRVPIGFYQKVWKILQK CHGLSVEGFVLPSSTTRE MTPGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLF

LQEQ KTLGADDTMLAKDPASGICTLLYDSAPSGRFGTMTYLSKAAATYVQEFLPHSLCAMQ
Transcript ENSMUST00000052012
Sequence
CCCGGTCTCCTTCAGTCAAGCGGAGGATGCCGGTGCGCCACCCGGGGACCACGGGAGACTGAGTGGAGACGGGGTCTTTGCCGGCCGAAGCCTAGACCGC

GGGAGGCTGAGCCGCGGCCTGAAGTGGACTCTGAGGCCGCCGGAACCAGGTGACGCGCGGGAACCATTGGCCACACGAGCAAGGGAGCGTTTAGAAGGTT

TCCGTAGGCCTGGCGTCCGAGCTTCCCGTGTGTGCAGTGGGGGATTAGGGACGTGGCACCATGAGGAGCCGCAGTAACTCGGGAGTCCGCCTGGACGGCT

ATGCTCGGCTGGTGCATCAGACCATCCTGTGCCATCAG AATCCAGTGACAGGCTTGCTTCCAGCCAGCTATGATCAAAAAGATGCCTGGGTCCGAGATA

ATGTGTACAGTATCCTGGCTGTGTGGGGTTTGGGCCTGGCATATCGCAAAAATGCTGACCGTGATGAGGACAAGGCAAAGGCCTATGAACTGGAGCAG A

GTGTAGTGAAGTTAATGAGGGGACTGCTGCACTGCATGATCAGACAG GTGGATAAAGTAGAGTCCTTCAAGTACAGTCAGAGTACTAAAGATAGCCTCC

ATGCCAAGTACAACACCAAAACTTGTGCCACTGTGGTGGGTGATGACCAGTGGGGACACCTGCAGTTGGATGCTACTTCTGTGTACCTGCTCTTCCTAGC

ACAAATGACTGCCTCAG GACTCCATATCATCCACAGCCTAGACGAAGTCAATTTTATACAGAACCTCGTGTTTTACATTGAAGCTGCATATAAAACTGC

T GACTTTGGGATATGGGAACGTGGCGATAAGACAAACCAAGGCATCTCGGAATTGAATGCGAGTTCAGTTGGAATGGCCAAG GCAGCCCTGGAAGCAC

TAGATGAATTAGACTTGTTTGGTGTGAAAGGTGGGCCACAATCAGTTATCCATGTCCTGGCTGATGAAGTCCAACACTGCCAG TCTATCCTGAATTCAC

TACTGCCCAGGGCTTCAACATCCAAAGAAGTTGATGCCAGTCTGCTCTCAGTGGTCTCTTTCCCAGCCTTTGCTGTAGAGGACAGCCATTTGGTGGAGCT

CACCAAACAGGAGATCATCACCAAGCTTCAG GGTCGTTATGGTTGCTGTCGTTTTCTGCGAGATGGATATAAAACTCCTAAAGAG GATCCCAATCGCC

TATACTATGAACCAGCTGAGCTGAAGCTATTTGAAAACATTGAGTGCGAATGGCCATTGTTCTGGACATACTTTATCCTTGATGGGATCTTCAGTGGCAA

CGTAGAACAG GTTCAAGAATATAGAGAGGCTCTTGATGCAGTCCTCATCAAGGGCAAAAATGGAGTCCCTCTTCTTCCAGAGCTGTACAGTGTCCCTCC

TGACAGG GTTGATGAAGAGTATCAAAATCCCCACACTGTGGATCGAGTCCCTATGGGAAAATTGCCTCACATGTGGGGTCAGTCTCTATACATTTTAGG

AAGCTTGATGGCAGAG GGATTTTTAGCTCCTGGAGAAATTGATCCCCTGAATCGTAGGTTTTCTACTGTGCCAAAGCCAGATGTGGTGGTTCAAG - U

NI37593 - TCTCCATTCTGGCTGAAACAGAAGAAATCAAGGCCATTTTGAAGGACAAAGGAATTGATGTGGAGACCATTGCTGAAGTGTACCCCATAA

GAGTACAGCCAGCTCGTATTCTCAGCCATATTTATTCTAGTCTAG - UNI37593 - GATGCAACAGTAGAATGAAACTCAGTGGACGACCCTACAGG

CTCATGGGTGTGCTTGGAACATCAAAACTTTATGACATTCGCAAAACTATCTTTACTTTCACTCCACAG - UNI37593 - TTTATAGACCAGCAACA

GTTCTACCTGGCTCTGGACAACCAGATGATAGTAGAAATGCTCAGAACAGACCTTTCCTACCTCTGTAGCCGCTGGAGGATGACAGGCCAGCCCACGATC

ACTTTCCCTATCTCGCACACCATGCTTG ATGAAGATGGAACCAGCTTGAATTCAAGTATCTTGGCAGCACTCCGAAAAATGCAGGATGGCTATTTTGGT

GGGGCCAG GATCCAAACAGGTAAATTGTCAGAGTTTTTGACAACATCTTGCTGCACACACTTAAGCTTCATGGACCCTGGACCTGAGGGTAAGCTGTAC

AGTGAAGATTATGATGAAGACTATGAAGATGATTTGGACTCTGGCAACTGGATGGACAGCTATGATTCAACAAGTAATG CTCGCTGTGGTGATGAAGTT

GCCCGTTATTTAGACCGCCTTTTGGCACACACTGTTCCCCATCCTAAACTAGCTCCTACCTCACGGAAGGGAGGGCTAGATCGGTTCCGAGCTGCTGTGC

AAACAACTTGCGACTTAATGTCCTTGGTGGCCAAGGCCAAGGAGCTGCATATACAGA ATGTTCACATGTATCTTCCTACAAAGTTATTTCAGCCTTCTC

GTCCTTCACTCAACTTACTTGACTCCCCTGAGTCTCCACAAGATAGCCAG GTTCCTTCCGTTCATGTAGAAGTGCATCTTCCTAGGGACCAGTCTGGGG

AAGTGGACTTCCAGTCATTGGTTTCACAGTTGAAGGAGACCTCAAGCTTACAGGAGCAAGCTGATATACTCTACATGCTGTATTCAATGAA AGGACCTG

ACTGGAACACTGAATTGTATGAAGAAGGGGGGGCTACTGTCAGAGAGCTTCTTAGTGAACTGTATGTCAAAGTTGGTGAAATTCGGCACTGGGGTCTGAT

CCGATATATCTCTGGGATCTTACGGAAGAAAGTGGAGGCACTTGATGAG GCCTGCACAGACCTTCTGTCCTACCAGAAACACCTGACAGTAGGACTTCC

TCCAGAACCTCGAGAGAAGACCATCTCTGC GCCTCTACCGTACGAGGCACTCACTAAGCTGATAGATGAAGCCAGTGAAGGCGACATGAGCATCTCAAC

CCTTACACAG GAAATAATGGTCTATCTTGCCATGTATATGAGAACTCAGCCTGGCCTCTTTGCAGAAATGTTCAGACTTCGAATCGGTTTGATCATACA

AGTTATGGCAACAGAACTAGCACACTCTCTTCGATGTTCAG CTGAGGAAGCCACAGAGGGCCTGATGAATCTCAGTCCTTCAGCCATGAAGAACCTCCT

GCATCACATTCTCAGTGGCAAAGAGTTTGGAGTGGAACGAAGCG TTCGTCCCACTGATTCAAATGTGAGTCCTGCTATTTCCATCCATGAGATTGGTGC

TGTTGGAGCAACAAAAACTGAACGAACTGGAATCATGCAGTTAAAAAGTGAGATAAAGCAG GTGGAATTTCGTAGGCTGTCTGTCTCGATGGAGAGTCA

G ACTAGTGGTGGTCATCCCTCGGGTGTAGATTTGATGTCGCCATCCTTTCTG TCCCCTGCAGCCTGTATTGCTGCAAGTAGTGGATCCTTTCCTACGG

TGTGTGATCATCAGACATCTAAAGATAGTCGTCAAGGCCAGTGGCAACGCAGGAGAAGGCTAGATGGAGCACTAAATAGAGTACCAATTGGATTTTATCA

AAAAGTATGGAAAATTTTGCAGAAA TGTCATGGGCTTTCTGTGGAAGGTTTTGTTCTTCCCTCTTCAACCACTAGGGAG ATGACCCCAGGTGAGATTA

AATTCTCTGTCCATGTGGAGTCTGTCCTGAATCGTGTCCCTCAGCCAGAATACCGCCAACTTCTGGTTGAAGCCATCCTTGTTCTCACCATGCTGGCAGA

TATTGAAATTCATAGCATTGGGAGCATCATTGCTGTGGAGAAAATAGTTCATATTGCCAACGACTTGTTCCTTCAAGAACAG AAAACCCTCGGCGCAGA

TGATACCATGTTGGCAAAGGATCCTGCATCTGGCATCTGTACTCTCCTGTATGACAGTGCACCCAGTGGCAGATTTGGCACCATGACCTACCTCTCCAAG

GCAGCTGCCACCTACGTGCAGGAGTTTCTGCCACACAGCCTCTGTGCCATGCAGTGAGGGCTGTGGGTTCTGCCTGTTAGAACACTTCAGTAGCTAGCCC

GTCTGGTTGATTGTGCATGGAACTGACATGTTAACACCTGATCACTCCCCCAGGCCCTTTTCCTGCCCCATCCCTCCTAGGAAGAGAGAACTTTGCTGAC

GATCTCACTACTTTTGAAGAAAAGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGCCCTATCTGGAGACTTGACTCCAGAGCGAAGGTTCAACTGCG

CCTGCAGTCACTATCCCTACTTTTGTGGTTCATAGAAGTCTGCATGTGCGTTGATTCTGTAGAGCTGTTAGTGGCTTAGTTTTTAAACTCCTATTGGGGA

GTAGGTATTAATAACTTATTCCTGTAAGTTGGTTTTCTTATTTGTTGGTTTTTACGTGTGTATATGAGTGGTGGGTATTGATTAGGCCATCATTTCAAGA

GAGTAGATGCTAAGTTGGATTTCGTGCTGCTGTAAATTGGAACTGTCGACTCTAAGTGCCTTTACTTAGGAAAAGCCAGTACCACATCATGGCTTCCTTC

TTCACTCAAAGGCTGCTTTGCTCTGAGTGGGGAAAGAGTGGGTGTTTTGTAGAAGCATTGCCTTTCATTGTTCTTTCTATATCTGTCCACAATGCCTACT

GTCTCTGTGGTGAAATATTAAAATATGTAAGCTC
Translation
MRSRSNSGVRLDGYARLVHQTILCHQ NPVTGLLPASYDQKDAWVRDNVYSILAVWGLGLAYRKNADRDEDKAKAYELEQ SVVKLMRGLLHCMIRQ VD

KVESFKYSQSTKDSLHAKYNTKTCATVVGDDQWGHLQLDATSVYLLFLAQMTASG GLHIIHSLDEVNFIQNLVFYIEAAYKTA DFGIWERGDKTNQGI

SELNASSVGMAK AALEALDELDLFGVKGGPQSVIHVLADEVQHCQ SILNSLLPRASTSKEVDASLLSVVSFPAFAVEDSHLVELTKQEIITKLQ GRY

GCCRFLRDGYKTPKE DPNRLYYEPAELKLFENIECEWPLFWTYFILDGIFSGNVEQ VQEYREALDAVLIKGKNGVPLLPELYSVPPDR VDEEYQNPH

TVDRVPMGKLPHMWGQSLYILGSLMAE GFLAPGEIDPLNRRFSTVPKPDVVVQV - UNI37593 - VSILAETEEIKAILKDKGIDVETIAEVYPIR

VQPARILSHIYSSLG - UNI37593 - GCNSRMKLSGRPYRLMGVLGTSKLYDIRKTIFTFTPQ - UNI37593 - FIDQQQFYLALDNQMIVEML

RTDLSYLCSRWRMTGQPTITFPISHTMLD DEDGTSLNSSILAALRKMQDGYFGGAR RIQTGKLSEFLTTSCCTHLSFMDPGPEGKLYSEDYDEDYEDD

LDSGNWMDSYDSTSNA ARCGDEVARYLDRLLAHTVPHPKLAPTSRKGGLDRFRAAVQTTCDLMSLVAKAKELHIQN NVHMYLPTKLFQPSRPSLNLLD

SPESPQDSQ VPSVHVEVHLPRDQSGEVDFQSLVSQLKETSSLQEQADILYMLYSMK KGPDWNTELYEEGGATVRELLSELYVKVGEIRHWGLIRYISG

ILRKKVEALDE ACTDLLSYQKHLTVGLPPEPREKTISA APLPYEALTKLIDEASEGDMSISTLTQ EIMVYLAMYMRTQPGLFAEMFRLRIGLIIQVM

ATELAHSLRCSA AEEATEGLMNLSPSAMKNLLHHILSGKEFGVERSV VRPTDSNVSPAISIHEIGAVGATKTERTGIMQLKSEIKQ VEFRRLSVSME

SQ TSGGHPSGVDLMSPSFL SPAACIAASSGSFPTVCDHQTSKDSRQGQWQRRRRLDGALNRVPIGFYQKVWKILQK CHGLSVEGFVLPSSTTRE MT

PGEIKFSVHVESVLNRVPQPEYRQLLVEAILVLTMLADIEIHSIGSIIAVEKIVHIANDLFLQEQ KTLGADDTMLAKDPASGICTLLYDSAPSGRFGTM

TYLSKAAATYVQEFLPHSLCAMQ

For any suggestions or comments, please send an email to unitrap@crg.es