Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034098 (Fstl5)
Chromosomal location
Chr 3: 75878520 - 76513926 (+)
Description
follistatin-like 5 Gene [Source:MGI Symbol;Acc:MGI:2442179]
RefSeq_dna
NM_178673 
RefSeq_peptide
NP_848788.2 
UniGene
Mm.379337 
MGI
MGI:2442179 
Uniprot/SWISSPROT
Q8BFR2 
Uniprot/SPTREMBL
Q3USA5 Q3UUI4 
Human Ortholog
ENSG00000168843 (FSTL5)
Omim not available
UniTrap UNI31173
Vector Insertion
Chr 3: 76027797 - 76125975
Public Clones IST14686B12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038364
Sequence
GGAGCTGGTGCTGTCCACAGAGTGTCGGTGCTGAACCCCGGGTGTAAGGGATCGCCTGCTTGGGCACCTGGAGGCAACGCCCACTGGAACCCTATGTGCC

CAGTGGGACCCGCTTCACCACAGGACCCAATTTAACTTGACAAAGGAGTGCGACTCGGACGTGGGAGAGACTCCTATGTTTGCAATCTGGGCGCCCACTC

AGGCGTGACTTTGGAGATTCTGTAGTTCTAACTCAAAGTATTTGGATTTTTTTTCCAACCTAAGAGGATCTTTTCATCGTTATTATTTTTCTTTTTTCTT

TTTTACACTGTGACTCATATTTTCACATCATTTAGAAATCTTTTTGGAGGACTTTTTTGTTTTTTACTTCAAATAAG GTGAAAATCAATAAAGATGTTT

AGGTGCTGGTCTGCCATTTTGATTCTTGGATTCATCTTTCTGGCATCTGAAGGGAGGCCAACAAAAGAATCAGGATATGGCCTTAAATCCTATCAACCTC

TTACAAGATTGCGACATAAG CAGGAAAAAAGTCAAGAAAGTTCAAGAATCAAAG - UNI31173 - AATTTCTAATTCATGATGGACCATTTGGATC

TTGTGAAAATAAGTACTGTGGCTTGGGGAGGCACTGTGTTATCAACAGAGAGACAAGGCATGCGGAGTGTGCCTGCATGGACCTTTGTAAACAGCACTAC

AAACCTGTGTGTGGATCTGATGGGGAATTCTATGAAAACCACTGTGAAGTGCACAGAGCTGCCTGTCTTAAAAAGCAAAAGATCACCATCGTTCACAATG

AAGACTGCTTCTTTGAAG GGGACAACTGCATGGCCATTGAATACAGCAAGATGAAAAGTATGCTTTTAGACTTACAAAATCAAAAGTATATTACACAAG

AAAATGAGAATCCCAACAGTGATGACATATCTAGGAAGAAGCCGTTGGTGGATCAAATGTTCAAGTATTTTGATGCAGACAGTAATGGACTTGTAGATAT

TAATGAACTAACTCAG GTGATTAAACAGGAGGAATTGAACAAGGACCTTTCTGACTGTACTTTGTATGATCTGCTCAAGTATGATGACTTCAACGCTGA

CAAGCACCTGGCTCTTGAAGAATTCTACAGAGCATTTC AGGTGATCCAGTTGAGTCTGCCTGAAGATCAGAGAGTAAGCATTACCGCAGCCACTGTGGG

GCAGAGTGCTGTTCTGAGCTGTGCCATTGTGGGAACGCTGAGACCCCCTATCATATGGAAGAGGAACAACATTGTTCTAAATAATTTAGATTTGGAAGAC

ATCAAT GACTTTGGTGATGATGGGTCCCTGTATATTACCAAGGTTACCACAGTTCACATGGGAAATTATACATGCTATGCAGATGGCTATGAAAATGTC

CGTCAGACACACATCTTCCAAGTGAATG TTCCTCCAGTTATCCGAGTGTATCCAGAGAGTCAGGCCAGAGAACCTGGTGTAACTGCAAGCCTTAGGTGC

CATGCCGAGGGCATTCCAGACCCTCAGCTTGGCTGGCTGAAGAATGGGATTGACATTACACCGAAGCTCTCCAAACAGCTCACACTTCAAG CAAATGGC

AGTGAGGTCCACATAAGCAATGTCCGTTATGAAGATACAGGAGCATACACGTGCATTGCTAGGAATGAAGCCGGTGTGGATGAAGACATCTCTTCTCTTT

TTGTGGAAGATTCTGCTAGGAAGACAC TAGCTAACATATTATGGAGAGAAGAAG GTCTGGGAATTGGGAACATGTTCTATGTTTTTTATGAAGATGGA

ATCAAAGTGATACAACCCACGGAATGTGAATTTCAGAGGCACATTAAGCCCAGTGAAAAGCTCCTTGGATATCAG GATGAAGTCTGTCCCAAAGCAGAA

GAGGATGAAGTGCAGAGATGTGTGTGGGCATCTGCTGTTAATGTCAAAGACAAGTTCATTTATGTCGCTCAGCCAACTTTGGACAGAATCTTGATTGTTG

ATGTGCAATCCCAAAAGGTTGTTCAG GCAGTGAGTACAGATCCTGTACCAGTTAAATTACACTACGACAAGTCACATGACCAAGTCTGGGTGCTGAGCT

GGGGCAGCATGGAGAAGACATCACCAACTCTACAG GTGATCACTCTGGCCAGCGGGAATGTGCCACACCACACCATCCACACTCAGCCAGTTGGGAAAC

AGTTTGACAGAGTGGACGATTTTTTTATTCCAACTCCAACACTTATTATTACTCACATGAG ATTTGGGTTTATTCTTCATAAAGATGAATCTGCACTAC

ACAAAATTGATCTCGAAACCATGTCCTACATCAAAACAATTAACCTGAAGGACTCACGATGCATTCCTCTATCCTTGGCATACACCCATCTGGGAGGATA

CTACTTCATAAGCTGCAAGGCTGACATCACCGGAGCTACTCCACCACAGCTCGTGGTAGACAGTGTGACTGACTCTATCATTGGCTTCAATAGCGATGTG

ACGGGCACTCCTTATGTCTCTCCAGACGGACACTATCTTGTCAGTGTTAATGACGTGAAAGGTCTTGTCAGAGTCCAATATATCACCATCCGAGGAGAGA

TTCTGGATGCTTTTGACATCCACACCAACCTACATATATCTGACCTGGCCTTCCAGCCATCCTTCACAGAAGCCCACCAGTACAACATCTATGGCAGCTC

AAGCCAACAAACAGATGTACTCTTTGTGGAGCTTTCCTCTGGGAAGGTCAAGATGATCAAAAGCCTCAAAGAACCTCTCAAGACAGAAGACTGGCCCTGG

AGCCAGAAAAACAGGCACATCCAAGGCAGTGGCCTGTTTGGACAGTACCTGATGACACCTTCCAAAGATTCTCTCTTCATCCTGGATGGTCGCCTTAATA

AATTAAACTGTGAGATCACTGAGGTTCAGAAAGGAAATACAGTTGTTTGGGTTGGCGATGCCTAAGGAGCCCTCTTACCTAATTATGAAAGAAGAGTTTT

ACAGTACATTGCACTTCATCCATATTTAAATTACAACTTAACTTTTCCAAATTTATATTCTAGTCAAATCCCCTCTGTTTGTTCAAATAAGATAGATTTT

TTTTTACAATGATAATTGGCTAGTTAGAAACATTTCATACAATATTTAATTGGAAATTACAGCACTCACAAGAATCAAACATGTAGCTATATTTTAAACC

AATGAAATGAGATTTAAATTATTTAAAAAAAAAATACACTGCAGGGAATTTCAGATGACCTAAGCATCATGTCATTCTTTACGGCATTTTTTTTTCCTCT

GTTATTTTGCTATGCTTAAATCAGAAATAAAAGGTCGTGTTAAACCTTAAAATTCTTAATTCAAAATACTCTGTCCCGTCCACTGTTTAAAATCTTTTGT

GCCTTGAAGGAAATGTCATGGAAGGAAAAAAAAAAAAGGAAGGCTAAGCTCTGCATATTGGACAACCTCATAAGCAATGAATCTACTGTCATTAAGAAAT

GTTTATATCTTGCGCCAAATCCTGCCTTCAGGCATTTGTTTGACCTTCAATGAAATGTCATGTGAAGGCATAATTTGGCCTTGGGCTGTATACAGATGAG

AAGCTATCCAACATTCACTGTACTATGTCCATTGTGCTATAGAAAATGGACAGGAAGGGAGAAAAATTTGTATGGTAAAAATGTTTGCAATGTATTGTGT

CCACATTTTGCTTTCATTCACTAGAGTGCATTATATTATTGGTGTATGATTATCTGGGAATTCAACTGCTTACAGAAGGTTTCCTTCTTTAGTATCAAGA

TTGATTCTTTTGTGTAGCCTAATGTTACATAAGTCAGGAGCTTTCTCAGTTCTGAAAAAGGAGCATGACTGTGTCTGCACAGAAAGAACCACTTCTAGGG

AAATTGACAGTGAGACAAAGCTGAAACCACTCTCTGTAGTGCGGTGGCCTATATCCTCTTCAGACAACATTCACTTGGTTGGTCCAAAGAAGGTGAATGG

GTTTTAGCAGAAAACAGTAACATGAGCCCACAGTAGAGATTGGGAAGTGAACTCCACTGCTTTTGCGATTTAGATGTATCTATTAAATAAATCCATCCTT

TATTAATGGTCAAGATGACTTCTACTCCTGCATATTCTAAACCACCCTCTCTTTAACTGTGTGCTCTAGCTGTAACCCAACGGAGTCTCTTGAGATATAG

TAGAGAAGTAAAAGTGACTGCCTTTATCCTTTTTCCTACAGGAGAAAACAGAAAAACAGTAGAAATAGATTAATACCAATAGTTTGGTTATTGGAATAAA

AGAAAACAATCCAGGTGTAAGGGAATAGCATACATGGTTTGAAAATCTTTTCTACTTATTTTTCTTCTTATTGTTGCTAAAACTCGTGATAAGCTATTGA

ACTAATGCCCATTTGCTGAAGGTAATCCAGTAAGATCTTTTTTTAAATACAAATTGGGTAAAACTGCATAGAAACTTGGGATTTTATAGTGTGCACTCTC

TTTTGTGTATATAGCACCATGGGCTGTGTGATAATAGATTTCTTCTTAGCTTAAGGATACATTAAGGGAAATAGATTTAATAAACAACAGAAATCAGCCT

ACATTTTTACTGATTGAGTCTGTTTTACTCTTTAGTAACTTCGTCCCCTGGGAACATGAATCATGCAGTGTCTTTGTGTTAATGATTTCGTGTAAGTCTA

TCCTGTACACGTACATCTTCTTTTAGAAGCTTTTACTATGTGGATGCTGTCTGTTATCATTGCTTGATAAAAGAATAAACCTCTTATGTTTT
Translation
 MFRCWSAILILGFIFLASEGRPTKESGYGLKSYQPLTRLRHK QEKSQESSRIKE - UNI31173 - EFLIHDGPFGSCENKYCGLGRHCVINRETR

HAECACMDLCKQHYKPVCGSDGEFYENHCEVHRAACLKKQKITIVHNEDCFFEG GDNCMAIEYSKMKSMLLDLQNQKYITQENENPNSDDISRKKPLVD

QMFKYFDADSNGLVDINELTQ VIKQEELNKDLSDCTLYDLLKYDDFNADKHLALEEFYRAFQ QVIQLSLPEDQRVSITAATVGQSAVLSCAIVGTLRP

PIIWKRNNIVLNNLDLEDIN DFGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNV VPPVIRVYPESQAREPGVTASLRCHAEGIPDPQLGWL

KNGIDITPKLSKQLTLQA ANGSEVHISNVRYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTL LANILWREEG GLGIGNMFYVFYEDGIKVIQPTE

CEFQRHIKPSEKLLGYQ DEVCPKAEEDEVQRCVWASAVNVKDKFIYVAQPTLDRILIVDVQSQKVVQ AVSTDPVPVKLHYDKSHDQVWVLSWGSMEKT

SPTLQ VITLASGNVPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMR RFGFILHKDESALHKIDLETMSYIKTINLKDSRCIPLSLAYTHLGGYYFIS

CKADITGATPPQLVVDSVTDSIIGFNSDVTGTPYVSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSQQT

DVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVQKGNTVVWVGDA

For any suggestions or comments, please send an email to unitrap@crg.es