Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034109 (Golim4)
Chromosomal location
Chr 3: 75680105 - 75760871 (-)
Description
golgi integral membrane protein 4 Gene [Source:MGI (curated);Acc:Golim4-002]
RefSeq_dna
NM_175193 
RefSeq_peptide
NP_780402.1 
UniGene
Mm.413269 
MGI
MGI:1920374 
Uniprot/SWISSPROT
Q8BXA1 
Human Ortholog
ENSG00000173905 (GOLIM4)
Omim not available
UniTrap UNI18092
Vector Insertion
Chr 3: 75715572 - 75760033
Public Clones not available
Private Clones OST430517 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000117242
Sequence
GGACTTCCTCCCGGAATCCCGTTGGCCATGATAGCGGGGCCGTGGGTGACACGTAAGTTGGGTGGGAGGTGGCGGGCGGCTGGAGCTTCCAGATCAGTGA

CACCAGCCCACCACCCCCCTTAACCTGACCAGACCAACCAGTCCCCATCTCTTCATCAATACCGAGGGACCGTTCAAGGGGACGCCGCCTGGAGCCAGGT

CCCTTTGTTGGGCGCGCGTCCCCTACCAGTGGTAGCGACAAAGTCCAGCAGCGGGAGCCGGCGCGAGGGGCGGGGACTGACGGTGGGGACAGCGAGGCCA

AAAAGTGGGGAGTAGGGAAAACCAAGCCGGCTGCGCGCGGGGACCAGTAGCAAGGGCAGCGGGCTCTGAAGTATGCAAAGAGACTCCACGCGGGCCCAGC

CACTCGCGGAAATCCGACATCGCAGAAGTTTGGTGGCTGCTGGCCGGGTGGCGTCGATGACCTGGCGCCCAGCCGGCCGCGGGGGCTGAGCGGCCGCCTC

TTCCTCTCTGGTCCGGCTTTTGTGTCTCGCGTCTTCTGCTCATGCCGTGTCCAGCTACTTCTCGCGGTGGCCGTTGCTGAGCTGTCCGACGCAGCCGAGG

ACCGAGGACACGACGGCTCCCGCCGCCGCAGCGCGGGGCACAGGAGGGACTATGGGAAACGGGATGTGCTCCCGAAAGCAGAAGCGGATCTTCCAGACGC

TGCTGCTTCTCACGGTGGTCTTCGGCTTCCTCTATGGCGCGATGCTCTACTTGGAACTGCAGACGCAGCTGCGCAAAGCTGAGGCAGTGGCGCTCAAGTA

CCAGCAGCACCAGGACTCTCTCTCTGCCCAGTTGCAAG - UNI18092 - TTGTATATGAACACAGATCAAGATTAGAGAAATCTTTGCAAAAAGAAA

GGCTTGAACACAAGAAAGCAAAGGAAG ATTTCCTTGTTTATAAGTTAGAAGCACAAGAAACACTTAACAAAGGAAGG CAAGATTCCAATAGCAGATAT

AGTGCATTGAATGTCCAACATCAGATGCTGAAA AGTCAGCATGAGGAGCTGAGGAAGCAGCACAGTGACCTGGAAGAGGAACACCGGAAGCAAGGGGAA

GACTTCAGTAGAACGTTCAATGACCACAAGCAGAGATACCTGCAGCTTCAGCAAGAAAAGGAACAAGAACTTTCTAAGCTAAAAG AAACTGTATATAAT

TTGAGAGAAGAGAATAGACAACTAAGAAAAGCACACCAAGACATTCACACACAGCTTCAAGACGTCAAG CAACAGCATAAGAATTTACTCTCCGAGCAT

GAACAGCTTGTAGTGACTTTGGAAGACCACAAGAGTGCACTGGCTGCTGCGCAG ACTCAAGTTGCAGAATATAAACAACTGAAAGATACACTGAACAGG

ATTCCAAGCTTTCGAAATCCTGACCCAGTCGAGCAGCAAAATGTCACCTTTCCCCATGGGACTCACCCTCCTCAAGGTTACAACGGAAGAGAGAAGCTGA

CAGGAGAGCTCCAAGAG GTGCAGCCGAATCACGAAGCAGGGCCTAGAAGAATGGAAGAGAAACCTCTGTCTTCCATGCAGAAGGATGCAGGATTCCAGG

CTCTAGAAGAGCAGAATCAAGTGGAACCCAGAGAGCCAGAGGAGCGTCAAGTGGAAGAGGAACACAGGAAGGCACTGGAGGAGGAGGAGATGGAGCAGGT

GGGGCAGGCGGAGCATCTGGAGGAAGAACACGACCCATCACCAGAGGAGCAGGATCGAGACTGGCGGGATCAGCAGGGACAGAATGCAGCCCACCTTCTG

GATGGCCACCCTCAAGCTGAG GTGGAGCATTCGACCAAGGCAGCTACAAACTTCCAATCCCCATATGAGGAACAGTTGGAACAGCAGAGGCTGGCAGCG

AGGAGAGATGAGGAAGCCCAGCGGCTGAGAGAACATCAGGAAGCCTTGCACCAACAGAGGCTCCATGGGCAGTTGCTAAGACAACAGCAGCAGCAACAGT

TCCTGGCCAGAGAGATGGCTCAGCAGAAGCAGGTAGCCCATGAAGATGGCCAGCAGCAGCACCAGGAGCAGCTAAG GCAGCAAGCTCATTACAATGCTG

TGGAGAATGACATCGCACAGGGAGTCGAGGACCAGGGAATCCCCGAAGAAGAGGGAGGTG CCTATGACAGAGATAACCAGCGCCAAGATGAAGCTGAAG

GAGACCCAGGCAACAGACAGGAACTTCGTGAACCAGGACACCAAGAAGGCGACCCTGAAGTTGAAGCAGAT AGGGCAGCTGTGGAGGATATAAACCCAG

CAGATGACCCCAACAATCAAGGCGAAGATGAATTTGAGGAAGCCGAGCAAGTGAGAGAAGAAAATTTGCCAGAGGAAAGTGAAGAGCAAAAACAAAGCGA

AGCAAAGCAAGGGAATGTAGAAATGGATGAGCACTTGGTG ATGGCAGGGAATCCAGACCAGCAGGAGGATAATGTTGATGAGCAGTATCAGGACGAAGG

AGAGGAAGAG GTTCAGGAAGATCTGACTGAAGAGAAAAAACGGGAAATGGAGCATAATGTTGAAGAGACATATGGTGAACAT CCTGATGATAAGAATA

ATGATGGTGAAGAACAAGGAGTTCACAACAGGGCGCATCCTAAAGGAAGACAGGAGCATTATGAGGAGGAGGAAGATGAAGAAGACGGGGCTGCTGTTGC

TGAGAAATCACATCGCAGAGCTGAAATGTAACTGGACTCAGTTTCTAGACTGTGCTCAGCCAACGATTTTTTTCTCAAGCTGCTCTAAAACAAATCCCGC

CTACTGAATTCTAGAGTATTTAATTACATACAGAAGTAAGGGTTTAGACTTTTTTAACTTTTTTATTAGAAATGCTATACATTTATATGAATATATTTTG

ATACCTTAGGTGAGAACTTCTTTTATAGTCGAGTTATACATGGACAAGAAGAAAAGCAGTAAGACTTGCCTTCAGGTCTGAATCTCATTTCCCAGCGATG

GTGGGAAGATGTGCTTGGCTTTGGTGCATGTCTCAGCTCAGTACCATTTTGTTTTCTGGCTTCCGGGTAGTCTACTATTTATCTCAGATAAAATGCAAGA

TATAGAAAAAAAAAGGTGTATGGAAAAACAATATGCAAACATCAGGGGAATGGCTGGTGTCCTCGTGGCTGTTCTTGCAGGTTCTTGTATACAGCTCTGA

AAGAATGTCACTACTGCAGAGTGTTGGCAAATGAGAGCCATCTGTACAGTTGAAAATCAATTGGAAAGCCCGTGTGTCTGTGTCGGTGTGTGTGCGTGCG

TGTCAGGACAAAGTTTTTTTTCAAACTTTCAGGTCACTTTGAATAATACGTAGCAATTCTTAAAATCACAGCTATCTTGCTTGAGAGGAATCACGTATGA

AAGTTGGATAATATTAATACCCCTATGAAAGTCTCAAGGACTCTGTCTTGTCAGAGAGGCCAAAGGAGCTGACACACTTAGAAATAGATGCAGTATGTTC

AGTGATGCTTCCTGGGTGAACTCCCCGTCTCCCCATCGGTTATCTGCTTGCTCGTCAGTCTCCACTTGCTCCAGCATATTTTCCTCTCTTAAGCTCTGTG

CCTTGATGTGGAACCATTTGGTTCACAGTTATGGATAGGAAAGCATGCGAAGCTACAGTTTAATAGGATTATTTTTCAGACTATATGATAAAATAACTAT

AGCACTAGGATAGGCACCCCTCCCTTAGCGGCTTTACTATTTACCCAGAATTGACCTGCCTTTGCCTATGTATGAGGCATTCTAATGGCTATCAAGAATA

ATGCATCCTTTAAAAGAAAACTCAAACTGAAAGGTTTTCCCTGAAATGAGCACATATTTTAGTTTACATCATCAATATTGTTAAATACATTGAACTGGGC

CACCGTTAATCTGTGTGTGGTACTTTCAAAATAATAAAGCAAATTTCATTTTCTGTTATTATCATATGAGTGTAATTTTAGTTTCTAATAACCACAATCA

TGTATGGTTTTGATTTTCCCAGCTGAGCAATTGTGTATGTATGCATAGGAAATGTTCCGCTCAAATTTAGTTTGGATTTCCAGTAACAATAAATCAAATC

TCATCTTTATGTATAAAAGCCCCATATGTAATGTAAAATGTATTATATTGTACATAAATACTCAGAATACAATTATTTTGGTAAATTAGTTTGTATTTTT

AATGTCCCTTTGCAGTATTTAATTATTTGAAACACATTGAAACTTGGGTAATAATCAATAAACTTATAAAAAGTTAAGGATAAGTCTTTTAAAGCATATA

ATTTCTTAGTGCTTTGTTATCTATGGTTTTTCTTTATAGGACAATATAAATTAATGAATTATTAAATGCCTTTCCCAAACTGCTTTATTTTTCTTTCTTT

TTCTGCTTTAATTGACACTTGAATTCTCATCATCAAACTTCTTTGAAAGAAGAAGCTAATAATTTCCATTATCTTTAAGGGCTAGAAATAAGAAATTGAA

CTAGAAAGGTATGTAAAACATGAGTGTCATATCCACAATTCATATGTAAATCTGGCCATTAAAGCAACAATCACAAACC
Translation
MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYLELQTQLRKAEAVALKYQQHQDSLSAQLQV - UNI18092 - VVYEHRSRLEKSLQKERLEHKKA

KED DFLVYKLEAQETLNKGR QDSNSRYSALNVQHQMLK SQHEELRKQHSDLEEEHRKQGEDFSRTFNDHKQRYLQLQQEKEQELSKLKE ETVYNLR

EENRQLRKAHQDIHTQLQDVK QQHKNLLSEHEQLVVTLEDHKSALAAAQ TQVAEYKQLKDTLNRIPSFRNPDPVEQQNVTFPHGTHPPQGYNGREKLT

GELQE VQPNHEAGPRRMEEKPLSSMQKDAGFQALEEQNQVEPREPEERQVEEEHRKALEEEEMEQVGQAEHLEEEHDPSPEEQDRDWRDQQGQNAAHLL

DGHPQAE VEHSTKAATNFQSPYEEQLEQQRLAARRDEEAQRLREHQEALHQQRLHGQLLRQQQQQQFLAREMAQQKQVAHEDGQQQHQEQLR RQQAHY

NAVENDIAQGVEDQGIPEEEGGA AYDRDNQRQDEAEGDPGNRQELREPGHQEGDPEVEAD RAAVEDINPADDPNNQGEDEFEEAEQVREENLPEESEE

QKQSEAKQGNVEMDEHLV MAGNPDQQEDNVDEQYQDEGEEE VQEDLTEEKKREMEHNVEETYGEH PDDKNNDGEEQGVHNRAHPKGRQEHYEEEEDE

EDGAAVAEKSHRRAEM
Transcript ENSMUST00000038563
Sequence
AATCCCGTTGGCCATGATAGCGGGGCCGTGGGTGACACGTAAGTTGGGTGGGAGGTGGCGGGCGGCTGGAGCTTCCAGATCAGTGACACCAGCCCACCAC

CCCCCTTAACCTGACCAGACCAACCAGTCCCCATCTCTTCATCAATACCGAGGGACCGTTCAAGGGGACGCCGCCTGGAGCCAGGTCCCTTTGTTGGGCG

CGCGTCCCCTACCAGTGGTAGCGACAAAGTCCAGCAGCGGGAGCCGGCGCGAGGGGCGGGGACTGACGGTGGGGACAGCGAGGCCAAAAAGTGGGGAGTA

GGGAAAACCAAGCCGGCTGCGCGCGGGGACCAGTAGCAAGGGCAGCGGGCTCTGAAGTATGCAAAGAGACTCCACGCGGGCCCAGCCACTCGCGGAAATC

CGACATCGCAGAAGTTTGGTGGCTGCTGGCCGGGTGGCGTCGATGACCTGGCGCCCAGCCGGCCGCGGGGGCTGAGCGGCCGCCTCTTCCTCTCTGGTCC

GGCTTTTGTGTCTCGCGTCTTCTGCTCATGCCGTGTCCAGCTACTTCTCGCGGTGGCCGTTGCTGAGCTGTCCGACGCAGCCGAGGACCGAGGACACGAC

GGCTCCCGCCGCCGCAGCGCGGGGCACAGGAGGGACTATGGGAAACGGGATGTGCTCCCGAAAGCAGAAGCGGATCTTCCAGACGCTGCTGCTTCTCACG

GTGGTCTTCGGCTTCCTCTATGGCGCGATGCTCTACTTGGAACTGCAGACGCAGCTGCGCAAAGCTGAGGCAGTGGCGCTCAAGTACCAGCAGCACCAGG

ACTCTCTCTCTGCCCAGTTGCAAG - UNI18092 - TTGTATATGAACACAGATCAAGATTAGAGAAATCTTTGCAAAAAGAAAGGCTTGAACACAAG

AAAGCAAAGGAAG ATTTCCTTGTTTATAAGTTAGAAGCACAAGAAACACTTAACAAAGGAAGG CAAGATTCCAATAGCAGATATAGTGCATTGAATGT

CCAACATCAGATGCTGAAA AGTCAGCATGAGGAGCTGAGGAAGCAGCACAGTGACCTGGAAGAGGAACACCGGAAGCAAGGGGAAGACTTCAGTAGAAC

GTTCAATGACCACAAGCAGAGATACCTGCAGCTTCAGCAAGAAAAGGAACAAGAACTTTCTAAGCTAAAAG AAACTGTATATAATTTGAGAGAAGAGAA

TAGACAACTAAGAAAAGCACACCAAGACATTCACACACAGCTTCAAGACGTCAAG ACTCAAGTTGCAGAATATAAACAACTGAAAGATACACTGAACAG

GATTCCAAGCTTTCGAAATCCTGACCCAGTCGAGCAGCAAAATGTCACCTTTCCCCATGGGACTCACCCTCCTCAAGGTTACAACGGAAGAGAGAAGCTG

ACAGGAGAGCTCCAAGAG GTGCAGCCGAATCACGAAGCAGGGCCTAGAAGAATGGAAGAGAAACCTCTGTCTTCCATGCAGAAGGATGCAGGATTCCAG

GCTCTAGAAGAGCAGAATCAAGTGGAACCCAGAGAGCCAGAGGAGCGTCAAGTGGAAGAGGAACACAGGAAGGCACTGGAGGAGGAGGAGATGGAGCAGG

TGGGGCAGGCGGAGCATCTGGAGGAAGAACACGACCCATCACCAGAGGAGCAGGATCGAGACTGGCGGGATCAGCAGGGACAGAATGCAGCCCACCTTCT

GGATGGCCACCCTCAAGCTGAG GTGGAGCATTCGACCAAGGCAGCTACAAACTTCCAATCCCCATATGAGGAACAGTTGGAACAGCAGAGGCTGGCAGC

GAGGAGAGATGAGGAAGCCCAGCGGCTGAGAGAACATCAGGAAGCCTTGCACCAACAGAGGCTCCATGGGCAGTTGCTAAGACAACAGCAGCAGCAACAG

TTCCTGGCCAGAGAGATGGCTCAGCAGAAGCAGGTAGCCCATGAAGATGGCCAGCAGCAGCACCAGGAGCAGCTAAG GCAGCAAGCTCATTACAATGCT

GTGGAGAATGACATCGCACAGGGAGTCGAGGACCAGGGAATCCCCGAAGAAGAGGGAGGTG CCTATGACAGAGATAACCAGCGCCAAGATGAAGCTGAA

GGAGACCCAGGCAACAGACAGGAACTTCGTGAACCAGGACACCAAGAAGGCGACCCTGAAGTTGAAGCAGAT AGGGCAGCTGTGGAGGATATAAACCCA

GCAGATGACCCCAACAATCAAGGCGAAGATGAATTTGAGGAAGCCGAGCAAGTGAGAGAAGAAAATTTGCCAGAGGAAAGTGAAGAGCAAAAACAAAGCG

AAGCAAAGCAAGGGAATGTAGAAATGGATGAGCACTTGGTG ATGGCAGGGAATCCAGACCAGCAGGAGGATAATGTTGATGAGCAGTATCAGGACGAAG

GAGAGGAAGAG GTTCAGGAAGATCTGACTGAAGAGAAAAAACGGGAAATGGAGCATAATGTTGAAGAGACATATGGTGAACAT CCTGATGATAAGAAT

AATGATGGTGAAGAACAAGGAGTTCACAACAGGGCGCATCCTAAAGGAAGACAGGAGCATTATGAGGAGGAGGAAGATGAAGAAGACGGGGCTGCTGTTG

CTGAGAAATCACATCGCAGAGCTGAAATGTAACTGGACTCAGTTTCTAGACTGTGCTCAGCCAACGATTTTTTTCTCAAGCTGCTCTAAAACAAATCCCG

CCTACTGAATTCTAGAGTATTTAATTACATACAGAAGTAAGGGTTTAGACTTTTTTAACTTTTTTATTAGAAATGCTATACATTTATATGAATATATTTT

GATACCTTAGGTGAGAACTTCTTTTATAGTCGAGTTATACATGGACAAGAAGAAAAGCAGTAAGACTTGCCTTCAGGTCTGAATCTCATTTCCCAGCGAT

GGTGGGAAGATGTGCTTGGCTTTGGTGCATGTCTCAGCTCAGTACCATTTTGTTTTCTGGCTTCCGGGTAGTCTACTATTTATCTCAGATAAAATGCAAG

ATATAGAAAAAAAAAGGTGTATGGAAAAACAATATGCAAACATCAGGGGAATGGCTGGTGTCCTCGTGGCTGTTCTTGCAGGTTCTTGTATACAGCTCTG

AAAGAATGTCACTACTGCAGAGTGTTGGCAAATGAGAGCCATCTGTACAGTTGAAAATCAATTGGAAAGCCCGTGTGTCTGTGTCGGTGTGTGTGCGTGC

GTGTCAGGACAAAGTTTTTTTTCAAACTTTCAGGTCACTTTGAATAATACGTAGCAATTCTTAAAATCACAGCTATCTTGCTTGAGAGGAATCACGTATG

AAAGTTGGATAATATTAATACCCCTATGAAAGTCTCAAGGACTCTGTCTTGTCAGAGAGGCCAAAGGAGCTGACACACTTAGAAATAGATGCAGTATGTT

CAGTGATGCTTCCTGGGTGAACTCCCCGTCTCCCCATCGGTTATCTGCTTGCTCGTCAGTCTCCACTTGCTCCAGCATATTTTCCTCTCTTAAGCTCTGT

GCCTTGATGTGGAACCATTTGGTTCACAGTTATGGATAGGAAAGCATGCGAAGCTACAGTTTAATAGGATTATTTTTCAGACTATATGATAAAATAACTA

TAGCACTAGGATAGGCACCCCTCCCTTAGCGGCTTTACTATTTACCCAGAATTGACCTGCCTTTGCCTATGTATGAGGCATTCTAATGGCTATCAAGAAT

AATGCATCCTTTAAAAGAAAACTCAAACTGAAAGGTTTTCCCTGAAATGAGCACATATTTTAGTTTACATCATCAATATTGTTAAATACATTGAACTGGG

CCACCGTTAATCTGTGTGTGGTACTTTCAAAATAATAAAGCAAATTTCATTTTCTGTTATTATCATATGAGTGTAATTTTAGTTTCTAATAACCACAATC

ATGTATGGTTTTGATTTTCCCAGCTGAGCAATTGTGTATGTATGCATAGGAAATGTTCCGCTCAAATTTAGTTTGGATTTCCAGTAACAATAAATCAAAT

CTCATCTTTATGTATAAAAGCCCCATATGTAATGTAAAATGTATTATATTGTACATAAATACTCAGAATACAATTATTTTGGTAAATTAGTTTGTATTTT

TAATGTCCCTTTGCAGTATTTAATTATTTGAAACACATTGAAACTTGGGTAATAATCAATAAACTTATAAAAAGTTAAGGATAAGTCTTTTAAAGC
Translation
MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYLELQTQLRKAEAVALKYQQHQDSLSAQLQV - UNI18092 - VVYEHRSRLEKSLQKERLEHKKA

KED DFLVYKLEAQETLNKGR QDSNSRYSALNVQHQMLK SQHEELRKQHSDLEEEHRKQGEDFSRTFNDHKQRYLQLQQEKEQELSKLKE ETVYNLR

EENRQLRKAHQDIHTQLQDVK TQVAEYKQLKDTLNRIPSFRNPDPVEQQNVTFPHGTHPPQGYNGREKLTGELQE VQPNHEAGPRRMEEKPLSSMQKD

AGFQALEEQNQVEPREPEERQVEEEHRKALEEEEMEQVGQAEHLEEEHDPSPEEQDRDWRDQQGQNAAHLLDGHPQAE VEHSTKAATNFQSPYEEQLEQ

QRLAARRDEEAQRLREHQEALHQQRLHGQLLRQQQQQQFLAREMAQQKQVAHEDGQQQHQEQLR RQQAHYNAVENDIAQGVEDQGIPEEEGGA AYDRD

NQRQDEAEGDPGNRQELREPGHQEGDPEVEAD RAAVEDINPADDPNNQGEDEFEEAEQVREENLPEESEEQKQSEAKQGNVEMDEHLV MAGNPDQQED

NVDEQYQDEGEEE VQEDLTEEKKREMEHNVEETYGEH PDDKNNDGEEQGVHNRAHPKGRQEHYEEEEDEEDGAAVAEKSHRRAEM

For any suggestions or comments, please send an email to unitrap@crg.es