Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034135 (BC033915)
Chromosomal location
Chr 9: 45820955 - 46032269 (+)
Description
Serine/threonine-protein kinase QSK (EC 2.7.11.1)(Salt-inducible kinase 3)(SIK-3)(SIK3) [Source:UniProtKB/Swiss-Prot;Acc:Q6P4S6]
RefSeq_peptide
NP_081774.3 
UniGene
Mm.219459 Mm.418402 
MGI
MGI:2446296 
Uniprot/SWISSPROT
Q6P4S6 
Human Ortholog
ENSG00000160584 (AP006216.1)
Omim not available
UniTrap UNI2858
Vector Insertion
Chr 9: 45821082 - 45821214
Public Clones AF0402 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1026
Vector Insertion
Chr 9: 45821106 - 45821214
Public Clones AY0649 (sanger) RRO411 (baygenomics) XM172 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13032
Vector Insertion
Chr 9: 45821214 - 45931299
Public Clones CMHD-GT_338A3-3 (cmhd) (cmhd) IST14714H3 (tigm) IST14406G5 (tigm)
IST14706C3 (tigm) IST12980C2 (tigm)
Private Clones OST464425 (lexicon) OST461681 (lexicon) OST414622 (lexicon) OST394071 (lexicon)
OST388382 (lexicon) OST375507 (lexicon) OST375365 (lexicon) OST360042 (lexicon)
OST328589 (lexicon) OST325609 (lexicon) OST322769 (lexicon) OST318832 (lexicon)
OST295388 (lexicon) OST246075 (lexicon) OST244356 (lexicon) OST202481 (lexicon)
OST169911 (lexicon) OST141694 (lexicon) OST129509 (lexicon) OST44455 (lexicon)
OST44434 (lexicon) OST43215 (lexicon) OST42948 (lexicon) OST23629 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32271
Vector Insertion
Chr 9: 45935157 - 45963461
Public Clones IST11560D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6199
Vector Insertion
Chr 9: 45963624 - 45985954
Public Clones CSG220 (baygenomics) YHC116 (baygenomics) IST10834A11 (tigm)
Private Clones OST451702 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17800
Vector Insertion
Chr 9: 45986639 - 46002245
Public Clones not available
Private Clones OST436248 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38059
Vector Insertion
Chr 9: 46006791 - 46010082
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15651
Vector Insertion
Chr 9: 46017748 - 46018558
Public Clones PST7147-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120247
Sequence
CGCGTCCCACAGCCCCGGCCTCCCGCGGGTCGATGGCCGCTCGCATCGGCTACTACGAGATCGACCGCACCATCGGCAAGGGCAACTTCGCTGTGGTCAA

GCGGGCCACGCACCTCGTCACCAAGGCCAAG - UNI1026 - - UNI2858 - - UNI13032 - GTTGCTATTAAAATCATAGATAAGAGCCAGC

TGGATGAAGAAAACTTGAAGAAGATTTTCCGGGAGGTTCAGATAATGAAGATGCTTTGCCATCCACACATCATCAGACTCTACCAG GTCATGGAGACAG

AGCGCATGATTTACCTGGTGACAGAATACGCTAGCGGAGGGGAGATATTTG - UNI32271 - ACCACTTGGTAGCCCATGGAAGAATGGCAGAGAAG

GAAGCTCGACGGAAGTTCAAACAGATCGTCACAGCGGTGTATTTTTGTCACTGTCGGAATATCGTTCATCGTGATTTAAAAGCCGAAAACTTACTTCTGG

ACGCCAATCTGAATATCAAAATAGCAG - UNI6199 - ACTTTGGCTTCAGCAACCTCTTCACTCCAGGGCAGCTGCTGAAGACGTGGTGTGGCAGCC

CTCCCTATGCCGCCCCAGAGCTCTTCGAAGGGAAGGAATATGATGGGCCCAAAGTGGACATATGG AGCCTTGGAGTTGTCCTCTATGTGCTGGTGTGTG

GCGCCCTGCCGTTTGATGGGAGCACACTGCAGAATCTGCGGGCCCGCGTGCTGAGTGGCAAGTTCCGCATCCCGTTCTTTATGTCCACAG - UNI1780

0 - AGTGTGAGCACTTGATCCGCCACATGCTGGTGTTAGATCCAAATAAGCGCCTCTCAATGGAACAGATCTGCAGGCACAAGTGGATGAAGCTCGGAG

ATGCAGACCCCAACTTTGACAGG TTAATAGCGGAGTGCCAGCAACTGAAGGAGGAAAGGCAGTCGGACCCCCTCAACGATGATGTCCTCTTGGCTATGG

AAGACATGGGGCTGGACAAGGAGCGCACACTTCAG GCGGAGCAGACAGGCACTGCTATGAACCTTAGCGTCCCTCAAGTTCAGCTGATCAACCCAGAGA

ACCAAATTATAGAG CCTGACGGGGCTGTGAACTTGGACAGTGATGAGGGTGAAGAGCCTTCTCCAGAAGCCTTGGTTCGCTATTTGTCAATGAGGAGGC

ACACGGTGGGAGTGGCTGACCCACG CACGGAAGTTATGGAAGATCTGCAGAAGCTGCTGCCTGGCTTTCCTGGAGTAAACCCACAGGGTCCATTCCTAC

AAGTGGCCCCTAACATGAACTTCACGCACAACCTGTTGCCCATGCAGAGTCTGCAGCCAACTGGGCAGCTTGAGTACAAG GAACAGTCTCTGTTACAGC

CGCCTACACTACAGCTACTGAACGGAATGGGGCCCCTTGGCCGGAGAGCCTCAGATGGAGGCGCCAACATCCAACTGCATGCCCAGCAGCTGCTCAAGCG

CCCACGGGGACCGTCCCCACTTGTCACCATGACACCA GCAGTGCCAGCAGTTACCCCTGTGGATGAGGAGAGCTCGGATGGGGAGCCAGATCAGGAAGC

TGTGCAGAG GTACTTGGCAAATAGGTCCAAAAGGCACACACTGGCCATGACCAGCCCGACAGCTGAGATCCCACCGGACCTGCAACGGCAGCTAGGACA

ACAGTCTTTCCGTTCCCGGGTCTGGCCTCCTCACCTGGTACCTGACCAGCATCG CTCCACCTACAAGGACTCCAACACCCTGCATCTCCCTACGGAGCG

TTTCTCCCCCGTGCGCCGGTTCTCAGACGGGGCTGCAAGCATCCAGGCCTTCAAAGCTCACCTGGAAAAAATGGGCAACAGCAGCAGCATCAAGCAGTTG

CAGCAG GAGTGTGAGCAGCTGCAGAAGATGTACGGGGGGCAGGTGGATGAGAGGACCCTGGAGAAGACCCAGCAGCAGCATATGTTGTACCAGCAGGAG

CAGCACCATCAGATCCTCCAGCAGCAAATCCAA GATTCTATTTGTCCTCCTCAGCCCTCCCCACCTCTTCAGGTTGCCTGTGAAAACCAACCAGCCCTC

CTCACCCACCAGCTCCAGAG GTTAAGGATTCAACCTTCAAGCCCACCCCCCAACCATCCCAGCAACCATCTCTTCAGACAGCCAAGTAACAGTCCTCCC

CCGGTCAGCAGTGCCATGATCACGTCTCACG - UNI15651 - GTGCTACGTCTCCCTCCCAGTTTCAAGGCTTACCCTCCCATGGTGCAATCTTCCA

GCAGCAACCCGAGAACTGTTCCCCGCCTCCCAGTGTAGCACTAACCTGCCTGGGCCTACAGCAGGCTAGCCAGTCACAGCCAGTGACTATCCAGCTACAG

GAGCCAGTTGACATGCTCAGCAACATGGCCGGAACCGCGGCAGGCTCTGCAGGGCGGAGCATCCCCATCAGCCCCAGCGCCAGTCAGATTCAGATACAGC

ACCGAGCCAGCCTAATGGCTCCCTTCAGCTATGGGCACCGGCCCTTGTCCAAGCAGCTGAGCGCTGACAGTGCAGAGGCCCACAG TGCCCAGCAGCAGC

CACCCCACTATACCACGTCAGCACTACAGCAGGCCCTGCTATCTCCTACACCGCCAGACTATCCCCGACACCAGCAGGTTCCCCATATCCTTCAAGGACT

GCTCTCTCCCCGGCATTCACTCACCGGCCACTCGGACATTCGGCTGCCTCCGGCAGAGTTTGCACAGCTCATCAAAAGGCAGCAACAGCATCGACAGCAG

CAGCAGCAGCAGCAGCAGCAACAAGAATACCATGAATTGTTCAGGCACATGAACCAAGGGGATGCTGTTAGCCTAGCTCCCAGCCTCGGGGGACAGAATA

TGACAGAGCAACAGGCTTTATCTTATCAAAATGCTGACTCGTACCACCGCCACCACACCAGCCCCCAGCATATCTTACAGATCAGGGCGCAAGATTGTAT

CTCACAGGGTCCCTCGCCCACCCCCACCCATGGCTATGCCCATCAGCCACCACTAATGCATTCGGAGAGTATGGAGGAAGACTGCTTGTGTGAGGGGCTC

AAGGAGGGCTTCCCAGACAAGAGCTCAAGCACACTGACCAAAGGTTGCCACAACAGCCCTCTGCTCTTGTGTACCAGTGGGCCTGGGGACCCTGAGCCTT

TGCTGGGAACTGTGAGTCAGGCCCGGGAGCTGGGGATCCATCCCTACGGACACCAGCCAACTGCCACCACGTTCAGTAGAAATAAGGTGCCCAGCCGAG 

AGTCTGTCCTAGGGAACTGCCTGGAAAGAAGTTCTCCTGGACAAGCAATGGAGCTGCCGGATCACAACGGCCTTGGGTACCCAGTACGGCCCTTAGTCAG

TGAGCACCTCAGGTCCCGGACGCTCCAGAGACACCACACGATCCAGAACAGCGACGATGCCTAT GTACAGCTGGATACCTTGCCAGGAATGAGCCTGGT

GGCAGGCAAGGCGCTGAGCTCTGCCCGGATGTCAGATGCAGTTCTTAGTCAGTCTTCACTCATGGGCAGCCAACAGTTTCAGGATGAGGAAGATGAAG A

ATGTGGGGTGAGCCTGGGCCACGAGCATCCAGGCCTGGGTGATGGCAGCCAGCATCTCAACTCCTCTCGCTATCCAGCTACGTGTGTTACAGACATCATG

CTCAGCCACAAGCACCCAGAGGTCTCCTTCAGCATGGAGCAAGCCGGCGTGTAGCAAGATATGGAAA
Translation
MAARIGYYEIDRTIGKGNFAVVKRATHLVTKAK - UNI1026 - - UNI2858 - - UNI13032 - VAIKIIDKSQLDEENLKKIFREVQIMKML

CHPHIIRLYQ VMETERMIYLVTEYASGGEIFD - UNI32271 - DHLVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKI

AD - UNI6199 - DFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIW SLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTE

 - UNI17800 - ECEHLIRHMLVLDPNKRLSMEQICRHKWMKLGDADPNFDR LIAECQQLKEERQSDPLNDDVLLAMEDMGLDKERTLQ AEQTGTA

MNLSVPQVQLINPENQIIE PDGAVNLDSDEGEEPSPEALVRYLSMRRHTVGVADPR RTEVMEDLQKLLPGFPGVNPQGPFLQVAPNMNFTHNLLPMQS

LQPTGQLEYK EQSLLQPPTLQLLNGMGPLGRRASDGGANIQLHAQQLLKRPRGPSPLVTMTP AVPAVTPVDEESSDGEPDQEAVQR RYLANRSKRHT

LAMTSPTAEIPPDLQRQLGQQSFRSRVWPPHLVPDQHR RSTYKDSNTLHLPTERFSPVRRFSDGAASIQAFKAHLEKMGNSSSIKQLQQ ECEQLQKMY

GGQVDERTLEKTQQQHMLYQQEQHHQILQQQIQ DSICPPQPSPPLQVACENQPALLTHQLQR RLRIQPSSPPPNHPSNHLFRQPSNSPPPVSSAMITS

HG - UNI15651 - GATSPSQFQGLPSHGAIFQQQPENCSPPPSVALTCLGLQQASQSQPVTIQLQEPVDMLSNMAGTAAGSAGRSIPISPSASQIQI

QHRASLMAPFSYGHRPLSKQLSADSAEAHS SAQQQPPHYTTSALQQALLSPTPPDYPRHQQVPHILQGLLSPRHSLTGHSDIRLPPAEFAQLIKRQQQH

RQQQQQQQQQQEYHELFRHMNQGDAVSLAPSLGGQNMTEQQALSYQNADSYHRHHTSPQHILQIRAQDCISQGPSPTPTHGYAHQPPLMHSESMEEDCLC

EGLKEGFPDKSSSTLTKGCHNSPLLLCTSGPGDPEPLLGTVSQARELGIHPYGHQPTATTFSRNKVPSRE ESVLGNCLERSSPGQAMELPDHNGLGYPV

RPLVSEHLRSRTLQRHHTIQNSDDAY VQLDTLPGMSLVAGKALSSARMSDAVLSQSSLMGSQQFQDEEDEE ECGVSLGHEHPGLGDGSQHLNSSRYPA

TCVTDIMLSHKHPEVSFSMEQAGV
Transcript ENSMUST00000120463
Sequence
GGCGAGCGGAGCTGGCGGGGTTGCCGTGGCCGGAGCAGGGGGAGCCGGGCCGGCCGGCCGCCTGCTGCCTCCGCCCGCCGCGGGGCCCCCGGCAGCCCCC

GCCGCAGTGCCCCCGGCCGCCGTCCCGGCGCGTCCCACAGCCCCGGCCTCCCGCGGGTCGATGGCCGCTCGCATCGGCTACTACGAGATCGACCGCACCA

TCGGCAAGGGCAACTTCGCTGTGGTCAAGCGGGCCACGCACCTCGTCACCAAGGCCAAG - UNI1026 - - UNI2858 - - UNI13032 - GTT

GCTATTAAAATCATAGATAAGAGCCAGCTGGATGAAGAAAACTTGAAGAAGATTTTCCGGGAGGTTCAGATAATGAAGATGCTTTGCCATCCACACATCA

TCAGACTCTACCAG GTCATGGAGACAGAGCGCATGATTTACCTGGTGACAGAATACGCTAGCGGAGGGGAGATATTTG - UNI32271 - ACCACTT

GGTAGCCCATGGAAGAATGGCAGAGAAGGAAGCTCGACGGAAGTTCAAACAGATCGTCACAGCGGTGTATTTTTGTCACTGTCGGAATATCGTTCATCGT

GATTTAAAAGCCGAAAACTTACTTCTGGACGCCAATCTGAATATCAAAATAGCAG - UNI6199 - ACTTTGGCTTCAGCAACCTCTTCACTCCAGGG

CAGCTGCTGAAGACGTGGTGTGGCAGCCCTCCCTATGCCGCCCCAGAGCTCTTCGAAGGGAAGGAATATGATGGGCCCAAAGTGGACATATGG AGCCTT

GGAGTTGTCCTCTATGTGCTGGTGTGTGGCGCCCTGCCGTTTGATGGGAGCACACTGCAGAATCTGCGGGCCCGCGTGCTGAGTGGCAAGTTCCGCATCC

CGTTCTTTATGTCCACAG - UNI17800 - AGTGTGAGCACTTGATCCGCCACATGCTGGTGTTAGATCCAAATAAGCGCCTCTCAATGGAACAGATC

TGCAGGCACAAGTGGATGAAGCTCGGAGATGCAGACCCCAACTTTGACAGG TTAATAGCGGAGTGCCAGCAACTGAAGGAGGAAAGGCAGTCGGACCCC

CTCAACGATGATGTCCTCTTGGCTATGGAAGACATGGGGCTGGACAAGGAGCGCACACTTCAG TCATTAAGGTCAGATGCCTATGACCACTATAGTGCA

ATCTACAGCCTGCTGTGCGATCGACACAAGAAACATAAAACTCTGCGTCCCGGAGCACTTCCCAGCATGCCCCAAGCCATGACTTTCCAGGCACCAGTCA

ATCTCCAG GCGGAGCAGACAGGCACTGCTATGAACCTTAGCGTCCCTCAAGTTCAGCTGATCAACCCAGAGAACCAAATTATAGAG CCTGACGGGGCT

GTGAACTTGGACAGTGATGAGGGTGAAGAGCCTTCTCCAGAAGCCTTGGTTCGCTATTTGTCAATGAGGAGGCACACGGTGGGAGTGGCTGACCCACG C

ACGGAAGTTATGGAAGATCTGCAGAAGCTGCTGCCTGGCTTTCCTGGAGTAAACCCACAGGGTCCATTCCTACAAGTGGCCCCTAACATGAACTTCACGC

ACAACCTGTTGCCCATGCAGAGTCTGCAGCCAACTGGGCAGCTTGAGTACAAG GAACAGTCTCTGTTACAGCCGCCTACACTACAGCTACTGAACGGAA

TGGGGCCCCTTGGCCGGAGAGCCTCAGATGGAGGCGCCAACATCCAACTGCATGCCCAGCAGCTGCTCAAGCGCCCACGGGGACCGTCCCCACTTGTCAC

CATGACACCA GCAGTGCCAGCAGTTACCCCTGTGGATGAGGAGAGCTCGGATGGGGAGCCAGATCAGGAAGCTGTGCAGAG CTCCACCTACAAGGACT

CCAACACCCTGCATCTCCCTACGGAGCGTTTCTCCCCCGTGCGCCGGTTCTCAGACGGGGCTGCAAGCATCCAGGCCTTCAAAGCTCACCTGGAAAAAAT

GGGCAACAGCAGCAGCATCAAGCAGTTGCAGCAG GAGTGTGAGCAGCTGCAGAAGATGTACGGGGGGCAGGTGGATGAGAGGACCCTGGAGAAGACCCA

GCAGCAGCATATGTTGTACCAGCAGGAGCAGCACCATCAGATCCTCCAGCAGCAAATCCAA GATTCTATTTGTCCTCCTCAGCCCTCCCCACCTCTTCA

GGTTGCCTGTGAAAACCAACCAGCCCTCCTCACCCACCAGCTCCAGAG GTTAAGGATTCAACCTTCAAGCCCACCCCCCAACCATCCCAGCAACCATCT

CTTCAGACAGCCAAGTAACAGTCCTCCCCCGGTCAGCAGTGCCATGATCACGTCTCACG - UNI15651 - GTGCTACGTCTCCCTCCCAGTTTCAAG

GCTTACCCTCCCATGGTGCAATCTTCCAGCAGCAACCCGAGAACTGTTCCCCGCCTCCCAGTGTAGCACTAACCTGCCTGGGCCTACAGCAGGCTAGCCA

GTCACAGCCAGTGACTATCCAGCTACAGGAGCCAGTTGACATGCTCAGCAACATGGCCGGAACCGCGGCAGGCTCTGCAGGGCGGAGCATCCCCATCAGC

CCCAGCGCCAGTCAGATTCAGATACAGCACCGAGCCAGCCTAATGGCTCCCTTCAGCTATGGGCACCGGCCCTTGTCCAAGCAGCTGAGCGCTGACAGTG

CAGAGGCCCACAG CTTGAACATGAATCGGTTCTCCCCTGCCAACTACGACCAGGCGCATTTACACCCCCATCTGTTTTCGGACCAGTCCCGAGGTTCCC

CCAGCAGCTACAGCCCTTCAACAGGAGTGGGGTTTCCTCCAACTCAAGCCCTGAAAGTTCCTCCGCTTGACCAGTTCCCCACTTTCCCTCCCAGTGCCCA

GCAGCAGCCACCCCACTATACCACGTCAGCACTACAGCAGGCCCTGCTATCTCCTACACCGCCAGACTATCCCCGACACCAGCAGGTTCCCCATATCCTT

CAAGGACTGCTCTCTCCCCGGCATTCACTCACCGGCCACTCGGACATTCGGCTGCCTCCGGCAGAGTTTGCACAGCTCATCAAAAGGCAGCAACAGCATC

GACAGCAGCAGCAGCAGCAGCAGCAGCAACAAGAATACCATGAATTGTTCAGGCACATGAACCAAGGGGATGCTGTTAGCCTAGCTCCCAGCCTCGGGGG

ACAGAATATGACAGAGCAACAGGCTTTATCTTATCAAAATGCTGACTCGTACCACCGCCACCACACCAGCCCCCAGCATATCTTACAGATCAGGGCGCAA

GATTGTATCTCACAGGGTCCCTCGCCCACCCCCACCCATGGCTATGCCCATCAGCCACCACTAATGCATTCGGAGAGTATGGAGGAAGACTGCTTGTGTG

AGGGGCTCAAGGAGGGCTTCCCAGACAAGAGCTCAAGCACACTGACCAAAGGTTGCCACAACAGCCCTCTGCTCTTGTGTACCAGTGGGCCTGGGGACCC

TGAGCCTTTGCTGGGAACTGTGAGTCAGGCCCGGGAGCTGGGGATCCATCCCTACGGACACCAGCCAACTGCCACCACGTTCAGTAGAAATAAGGTGCCC

AGCCGAG AGTCTGTCCTAGGGAACTGCCTGGAAAGAAGTTCTCCTGGACAAGCAATGGAGCTGCCGGATCACAACGGCCTTGGGTACCCAGTACGGCCC

TTAGTCAGTGAGCACCTCAGGTCCCGGACGCTCCAGAGACACCACACGATCCAGAACAGCGACGATGCCTAT GTACAGCTGGATACCTTGCCAGGAATG

AGCCTGGTGGCAGGCAAGGCGCTGAGCTCTGCCCGGATGTCAGATGCAGTTCTTAGTCAGTCTTCACTCATGGGCAGCCAACAGTTTCAGGATGAGGAAG

ATGAAG AATGTGGGGTGAGCCTGGGCCACGAGCATCCAGGCCTGGGTGATGGCAGCCAGCATCTCAACTCCTCTCGCTATCCAGCTACGTGTGTTACAG

ACATCATGCTCAGCCACAAGCACCCAGAGGTCTCCTTCAGCATGGAGCAAGCCGGCGTGTAGCAAGATATGGAAA GTTCGAGTACAGCTCCAGGAGGAG

GCTGAGTCTAGACCAATAGACCAACAGTGTCCAACAGCGCCGCACCGCTCCTCCGTCTGTGTCTCCACCACAACAGTGCAGCTCCTTCCCCTACACTAGG

CACCAGTAGGCCGGCGCTTGGGTTGCGAGGGACATTTGCCATGTTTGCTTGTATGACCAAGGCACCAAGGAAATAAACAGGAA
Translation
MAARIGYYEIDRTIGKGNFAVVKRATHLVTKAK - UNI1026 - - UNI2858 - - UNI13032 - VAIKIIDKSQLDEENLKKIFREVQIMKML

CHPHIIRLYQ VMETERMIYLVTEYASGGEIFD - UNI32271 - DHLVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKI

AD - UNI6199 - DFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIW SLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTE

 - UNI17800 - ECEHLIRHMLVLDPNKRLSMEQICRHKWMKLGDADPNFDR LIAECQQLKEERQSDPLNDDVLLAMEDMGLDKERTLQ SLRSDAY

DHYSAIYSLLCDRHKKHKTLRPGALPSMPQAMTFQAPVNLQ AEQTGTAMNLSVPQVQLINPENQIIE PDGAVNLDSDEGEEPSPEALVRYLSMRRHTV

GVADPR RTEVMEDLQKLLPGFPGVNPQGPFLQVAPNMNFTHNLLPMQSLQPTGQLEYK EQSLLQPPTLQLLNGMGPLGRRASDGGANIQLHAQQLLKR

PRGPSPLVTMTP AVPAVTPVDEESSDGEPDQEAVQS SSTYKDSNTLHLPTERFSPVRRFSDGAASIQAFKAHLEKMGNSSSIKQLQQ ECEQLQKMYG

GQVDERTLEKTQQQHMLYQQEQHHQILQQQIQ DSICPPQPSPPLQVACENQPALLTHQLQR RLRIQPSSPPPNHPSNHLFRQPSNSPPPVSSAMITSH

G - UNI15651 - GATSPSQFQGLPSHGAIFQQQPENCSPPPSVALTCLGLQQASQSQPVTIQLQEPVDMLSNMAGTAAGSAGRSIPISPSASQIQIQ

HRASLMAPFSYGHRPLSKQLSADSAEAHS SLNMNRFSPANYDQAHLHPHLFSDQSRGSPSSYSPSTGVGFPPTQALKVPPLDQFPTFPPSAQQQPPHYT

TSALQQALLSPTPPDYPRHQQVPHILQGLLSPRHSLTGHSDIRLPPAEFAQLIKRQQQHRQQQQQQQQQQEYHELFRHMNQGDAVSLAPSLGGQNMTEQQ

ALSYQNADSYHRHHTSPQHILQIRAQDCISQGPSPTPTHGYAHQPPLMHSESMEEDCLCEGLKEGFPDKSSSTLTKGCHNSPLLLCTSGPGDPEPLLGTV

SQARELGIHPYGHQPTATTFSRNKVPSRE ESVLGNCLERSSPGQAMELPDHNGLGYPVRPLVSEHLRSRTLQRHHTIQNSDDAY VQLDTLPGMSLVAG

KALSSARMSDAVLSQSSLMGSQQFQDEEDEE ECGVSLGHEHPGLGDGSQHLNSSRYPATCVTDIMLSHKHPEVSFSMEQAGV 
Transcript ENSMUST00000078669
Sequence
GCGGGTCGATGGCCGCTCGCATCGGCTACTACGAGATCGACCGCACCATCGGCAAGGGCAACTTCGCTGTGGTCAAGCGGGCCACGCACCTCGTCACCAA

GGCCAAG - UNI1026 - - UNI2858 - - UNI13032 - GTTGCTATTAAAATCATAGATAAGAGCCAGCTGGATGAAGAAAACTTGAAGAAGA

TTTTCCGGGAGGTTCAGATAATGAAGATGCTTTGCCATCCACACATCATCAGACTCTACCAG GTCATGGAGACAGAGCGCATGATTTACCTGGTGACAG

AATACGCTAGCGGAGGGGAGATATTTG - UNI32271 - ACCACTTGGTAGCCCATGGAAGAATGGCAGAGAAGGAAGCTCGACGGAAGTTCAAACAG

ATCGTCACAGCGGTGTATTTTTGTCACTGTCGGAATATCGTTCATCGTGATTTAAAAGCCGAAAACTTACTTCTGGACGCCAATCTGAATATCAAAATAG

CAG - UNI6199 - ACTTTGGCTTCAGCAACCTCTTCACTCCAGGGCAGCTGCTGAAGACGTGGTGTGGCAGCCCTCCCTATGCCGCCCCAGAGCTCT

TCGAAGGGAAGGAATATGATGGGCCCAAAGTGGACATATGG AGCCTTGGAGTTGTCCTCTATGTGCTGGTGTGTGGCGCCCTGCCGTTTGATGGGAGCA

CACTGCAGAATCTGCGGGCCCGCGTGCTGAGTGGCAAGTTCCGCATCCCGTTCTTTATGTCCACAG - UNI17800 - AGTGTGAGCACTTGATCCGC

CACATGCTGGTGTTAGATCCAAATAAGCGCCTCTCAATGGAACAGATCTGCAGGCACAAGTGGATGAAGCTCGGAGATGCAGACCCCAACTTTGACAGG 

TTAATAGCGGAGTGCCAGCAACTGAAGGAGGAAAGGCAGTCGGACCCCCTCAACGATGATGTCCTCTTGGCTATGGAAGACATGGGGCTGGACAAGGAGC

GCACACTTCAG TCATTAAGGTCAGATGCCTATGACCACTATAGTGCAATCTACAGCCTGCTGTGCGATCGACACAAGAAACATAAAACTCTGCGTCCCG

GAGCACTTCCCAGCATGCCCCAAGCCATGACTTTCCAGGCACCAGTCAATCTCCAG GCGGAGCAGACAGGCACTGCTATGAACCTTAGCGTCCCTCAAG

TTCAGCTGATCAACCCAGAGAACCAAATTATAGAG CCTGACGGGGCTGTGAACTTGGACAGTGATGAGGGTGAAGAGCCTTCTCCAGAAGCCTTGGTTC

GCTATTTGTCAATGAGGAGGCACACGGTGGGAGTGGCTGACCCACG CACGGAAGTTATGGAAGATCTGCAGAAGCTGCTGCCTGGCTTTCCTGGAGTAA

ACCCACAGGGTCCATTCCTACAAGTGGCCCCTAACATGAACTTCACGCACAACCTGTTGCCCATGCAGAGTCTGCAGCCAACTGGGCAGCTTGAGTACAA

G GAACAGTCTCTGTTACAGCCGCCTACACTACAGCTACTGAACGGAATGGGGCCCCTTGGCCGGAGAGCCTCAGATGGAGGCGCCAACATCCAACTGCA

TGCCCAGCAGCTGCTCAAGCGCCCACGGGGACCGTCCCCACTTGTCACCATGACACCA GCAGTGCCAGCAGTTACCCCTGTGGATGAGGAGAGCTCGGA

TGGGGAGCCAGATCAGGAAGCTGTGCAGAG GTACTTGGCAAATAGGTCCAAAAGGCACACACTGGCCATGACCAGCCCGACAGCTGAGATCCCACCGGA

CCTGCAACGGCAGCTAGGACAACAGTCTTTCCGTTCCCGGGTCTGGCCTCCTCACCTGGTACCTGACCAGCATCG CTCCACCTACAAGGACTCCAACAC

CCTGCATCTCCCTACGGAGCGTTTCTCCCCCGTGCGCCGGTTCTCAGACGGGGCTGCAAGCATCCAGGCCTTCAAAGCTCACCTGGAAAAAATGGGCAAC

AGCAGCAGCATCAAGCAGTTGCAGCAG GAGTGTGAGCAGCTGCAGAAGATGTACGGGGGGCAGGTGGATGAGAGGACCCTGGAGAAGACCCAGCAGCAG

CATATGTTGTACCAGCAGGAGCAGCACCATCAGATCCTCCAGCAGCAAATCCAA GATTCTATTTGTCCTCCTCAGCCCTCCCCACCTCTTCAGGTTGCC

TGTGAAAACCAACCAGCCCTCCTCACCCACCAGCTCCAGAG GTTAAGGATTCAACCTTCAAGCCCACCCCCCAACCATCCCAGCAACCATCTCTTCAGA

CAGCCAAGTAACAGTCCTCCCCCGGTCAGCAGTGCCATGATCACGTCTCACG - UNI15651 - GTGCTACGTCTCCCTCCCAGTTTCAAGGCTTACC

CTCCCATGGTGCAATCTTCCAGCAGCAACCCGAGAACTGTTCCCCGCCTCCCAGTGTAGCACTAACCTGCCTGGGCCTACAGCAGGCTAGCCAGTCACAG

CCAGTGACTATCCAGCTACAGGAGCCAGTTGACATGCTCAGCAACATGGCCGGAACCGCGGCAGGCTCTGCAGGGCGGAGCATCCCCATCAGCCCCAGCG

CCAGTCAGATTCAGATACAGCACCGAGCCAGCCTAATGGCTCCCTTCAGCTATGGGCACCGGCCCTTGTCCAAGCAGCTGAGCGCTGACAGTGCAGAGGC

CCACAG CTTGAACATGAATCGGTTCTCCCCTGCCAACTACGACCAGGCGCATTTACACCCCCATCTGTTTTCGGACCAGTCCCGAGGTTCCCCCAGCAG

CTACAGCCCTTCAACAGGAGTGGGGTTTCCTCCAACTCAAGCCCTGAAAGTTCCTCCGCTTGACCAGTTCCCCACTTTCCCTCCCAGTGCCCAGCAGCAG

CCACCCCACTATACCACGTCAGCACTACAGCAGGCCCTGCTATCTCCTACACCGCCAGACTATCCCCGACACCAGCAGGTTCCCCATATCCTTCAAGGAC

TGCTCTCTCCCCGGCATTCACTCACCGGCCACTCGGACATTCGGCTGCCTCCGGCAGAGTTTGCACAGCTCATCAAAAGGCAGCAACAGCATCGACAGCA

GCAGCAGCAGCAGCAGCAGCAACAAGAATACCATGAATTGTTCAGGCACATGAACCAAGGGGATGCTGTTAGCCTAGCTCCCAGCCTCGGGGGACAGAAT

ATGACAGAGCAACAGGCTTTATCTTATCAAAATGCTGACTCGTACCACCGCCACCACACCAGCCCCCAGCATATCTTACAGATCAGGGCGCAAGATTGTA

TCTCACAGGGTCCCTCGCCCACCCCCACCCATGGCTATGCCCATCAGCCACCACTAATGCATTCGGAGAGTATGGAGGAAGACTGCTTGTGTGAGGGGCT

CAAGGAGGGCTTCCCAGACAAGAGCTCAAGCACACTGACCAAAGGTTGCCACAACAGCCCTCTGCTCTTGTGTACCAGTGGGCCTGGGGACCCTGAGCCT

TTGCTGGGAACTGTGAGTCAGGCCCGGGAGCTGGGGATCCATCCCTACGGACACCAGCCAACTGCCACCACGTTCAGTAGAAATAAGGTGCCCAGCCGAG

 AGTCTGTCCTAGGGAACTGCCTGGAAAGAAGTTCTCCTGGACAAGCAATGGAGCTGCCGGATCACAACGGCCTTGGGTACCCAGTACGGCCCTTAGTCA

GTGAGCACCTCAGGTCCCGGACGCTCCAGAGACACCACACGATCCAGAACAGCGACGATGCCTAT GTACAGCTGGATACCTTGCCAGGAATGAGCCTGG

TGGCAGGCAAGGCGCTGAGCTCTGCCCGGATGTCAGATGCAGTTCTTAGTCAGTCTTCACTCATGGGCAGCCAACAGTTTCAGGATGAGGAAGATGAAG 

AATGTGGGGTGAGCCTGGGCCACGAGCATCCAGGCCTGGGTGATGGCAGCCAGCATCTCAACTCCTCTCGCTATCCAGCTACGTGTGTTACAGACATCAT

GCTCAGCCACAAGCACCCAGAGGTCTCCTTCAGCATGGAGCAAGCCGGCGTGTAGCAAGATATGGAAA GTTCGAGTACAGCTCCAGGAGGAGGCTGAGT

CTAGACCAATAGACCAACAGTGTCCAACAGCGCCGCACCGCTCCTCCGTCTGTGTCTCCACCACAACAGTGCAGCTCCTTCCCCTACACTAGGCACCAGT

AGGCCGGCGCTTGGGTTGCGAGGGACATTTGCCATGTTTGCTTGTATGACCAAGGCACCAAGGAAATAAACAGGAAATCAGTGTCCTCCATCTTTCATGA

GCCAGCATCTGGTGTGCTTGAGTTGAGTTCTGCTGTTAGGAGGTTTGCTTGTGTTTTGTTTTGGAAATTTTCCTTTGGAGATAACTTATTCTCTTTGCCT

TGCCCACCCCTACCCCCTTGAGCATATTCCCCCCCCCCTCTCGTTTTCACCTACCATTTCTGAGGTAGATGAACCAGAGGTTAGTATTCAGGGGCTGAAC

CTCAGGACCCTCCCTTCCACAGCCTGTCTCAGACCAGACTCTCTCCCTCTGCCCCGGTCTACCAGGAACAAATGCTAGACCGGAGCTTGGTGGCCAAGAA

AAGGAGAGGAGGGGGCAGTGGCCCCTGCCTTTGGAGATTGGAACAGAAGAAAAAACTGAGCCTGGGATCTGGCAGAATCTCCTGCTGGCCTCTACTAGAA

TCCTATCTGGCCCAGCAGAATTCCATCAGATCCCAGCACAGGCCGGATGGCCTGGTGCTGAAGGTTTGCCATCCAGAATAGCTCAGTGTAGGCCCCTCTG

GTGTGTGGTCCAGTTCCCCTCCAGTCACCAACTGGTTCCCCCTCATGAGTGAACACCCAGGAGTGGTGCACTGTGCTGTTTGTGTGATCTCCATTCTTAT

TCTCTACTGCGTTGTAAAAAGGGCCGTTGGTCCATTTGTGTGCACACGTATGAGTGTGTACATGCCCTTCCCTGCGGCCTCTTTGTCACAGACAAGAATT

GGAGGCTGTACTGGGTCTCTTAACCTTCTCCTCTCCCCAGCATCCTCGGCCCCTATATTTTAATTCTTGATCATGTAGGAATTGTTTTTGATAAATGTTG

ATATTATTGTTATTATTGTTATTATTAATAAAGACAAAAAGGATTTTGTTTATTTGTTTAAAAGAGAAATGTTTAACCAGATTCTGTGCTGTTGAACTGT

GGCTTGCAACTTCTGTTTGAAGTGTTTTCCTTGGCTTTGGCATCGTGAGCCACTCTCCTGTGCCAGCAGCGGATGCAGTGGCCTCCCTTCCCCAGCCGAA

GCAGCACATAGGCAGTGGCTACTGTCCTTGTCACTTCCTTTCTCTCTGCAGTCAGAAACCAAAGTCTGGGGCCAAACGAGGCCGGCCCGGCTTCTCTTCT

GGTCTTCAAAACCAGAGAGGGATGGTCCCTGCTCTGACTCCCAGCCCTCATTTCTGAGAGCCAGGGGCCACCAACCTCTGAGTATGCACAGAAGAAAGCC

GCTGCCTGCCATGGCATCTGGACATTACCAGCAGGGTCCCTAGCCATTTTATCCTTCCGCACCAACCCTGAAAGCTTGCCTCTTTGAACAAATCCATTGT

CTCTTGAATGGATTTGTTTTCAATGTGAGAGCTTGGCTGGGGACCTGTTTCGTGGTCCCATGTCCTCCAATTTCCCCTCCACTTCAGGTGTCACTAATTA

CTAGCCAGAAGATGTCTGACTCCCAAGAAAGCTTGACAAGCCATTGTCAGCTTCCAAGCTCAGTCCAGCTCTGATACTCCAGCCCCGCCCTGCTGCTCCC

CACGCTCAGCCTGACCTGTTTACGTGGTACTGGATTGATGGAAGAGCAGGCACCACCCTCCAGAGCCACCCAGACGAAAGCCAGTGAGCCTATTAACCGT

GCCATCTTGCGAACTATTTTCAAGATCACCATTGCTTTATATTGTAGTAACCAATATGCGCAGTATATGTTGAATGTATATGAATCTACTTTGCTATTTC

TGTTCTTTGAAAATGTAAGAAGTATTTTTCCTTTCTCATTTCTGTTGATCTAAAAATGATAATAATAATAATAATCTCCAGATTCAAGTTGCTAAGAGCT

TTTGTCCTTGTTTGTGTGGGACATCTACAACTTAGTGACTTGGTTGGACTGTAGGAGGTTGTGGAAATAAAAACCTGATTATGTACT
Translation
MAARIGYYEIDRTIGKGNFAVVKRATHLVTKAK - UNI1026 - - UNI2858 - - UNI13032 - VAIKIIDKSQLDEENLKKIFREVQIMKML

CHPHIIRLYQ VMETERMIYLVTEYASGGEIFD - UNI32271 - DHLVAHGRMAEKEARRKFKQIVTAVYFCHCRNIVHRDLKAENLLLDANLNIKI

AD - UNI6199 - DFGFSNLFTPGQLLKTWCGSPPYAAPELFEGKEYDGPKVDIW SLGVVLYVLVCGALPFDGSTLQNLRARVLSGKFRIPFFMSTE

 - UNI17800 - ECEHLIRHMLVLDPNKRLSMEQICRHKWMKLGDADPNFDR LIAECQQLKEERQSDPLNDDVLLAMEDMGLDKERTLQ SLRSDAY

DHYSAIYSLLCDRHKKHKTLRPGALPSMPQAMTFQAPVNLQ AEQTGTAMNLSVPQVQLINPENQIIE PDGAVNLDSDEGEEPSPEALVRYLSMRRHTV

GVADPR RTEVMEDLQKLLPGFPGVNPQGPFLQVAPNMNFTHNLLPMQSLQPTGQLEYK EQSLLQPPTLQLLNGMGPLGRRASDGGANIQLHAQQLLKR

PRGPSPLVTMTP AVPAVTPVDEESSDGEPDQEAVQR RYLANRSKRHTLAMTSPTAEIPPDLQRQLGQQSFRSRVWPPHLVPDQHR RSTYKDSNTLHL

PTERFSPVRRFSDGAASIQAFKAHLEKMGNSSSIKQLQQ ECEQLQKMYGGQVDERTLEKTQQQHMLYQQEQHHQILQQQIQ DSICPPQPSPPLQVACE

NQPALLTHQLQR RLRIQPSSPPPNHPSNHLFRQPSNSPPPVSSAMITSHG - UNI15651 - GATSPSQFQGLPSHGAIFQQQPENCSPPPSVALTC

LGLQQASQSQPVTIQLQEPVDMLSNMAGTAAGSAGRSIPISPSASQIQIQHRASLMAPFSYGHRPLSKQLSADSAEAHS SLNMNRFSPANYDQAHLHPH

LFSDQSRGSPSSYSPSTGVGFPPTQALKVPPLDQFPTFPPSAQQQPPHYTTSALQQALLSPTPPDYPRHQQVPHILQGLLSPRHSLTGHSDIRLPPAEFA

QLIKRQQQHRQQQQQQQQQQEYHELFRHMNQGDAVSLAPSLGGQNMTEQQALSYQNADSYHRHHTSPQHILQIRAQDCISQGPSPTPTHGYAHQPPLMHS

ESMEEDCLCEGLKEGFPDKSSSTLTKGCHNSPLLLCTSGPGDPEPLLGTVSQARELGIHPYGHQPTATTFSRNKVPSRE ESVLGNCLERSSPGQAMELP

DHNGLGYPVRPLVSEHLRSRTLQRHHTIQNSDDAY VQLDTLPGMSLVAGKALSSARMSDAVLSQSSLMGSQQFQDEEDEE ECGVSLGHEHPGLGDGSQ

HLNSSRYPATCVTDIMLSHKHPEVSFSMEQAGV 

For any suggestions or comments, please send an email to unitrap@crg.es