Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034152 (Exoc3)
Chromosomal location
Chr 13: 74309441 - 74346139 (-)
Description
exocyst complex component 3 Gene [Source:MGI Symbol;Acc:MGI:2443972]
RefSeq_dna
NM_177333 
RefSeq_peptide
NP_796307.2 
UniGene
Mm.261859 
MGI
MGI:2443972 
Uniprot/SWISSPROT
Q6KAR6 
Uniprot/SPTREMBL
Q8BIT7 Q8K0E2 Q9ET46 
Human Ortholog
ENSG00000180104 (EXOC3)
Omim not available
UniTrap UNI26160
Vector Insertion
Chr 13: 74344546 - 74346105
Public Clones not available
Private Clones OST133582 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21051
Vector Insertion
Chr 13: 74311597 - 74317882
Public Clones not available
Private Clones OST344586 (lexicon)
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035934
Sequence
CCGGCTCCGGGAGGTGGCAGCGGCGTTGCGGACG - UNI26160 - TGTACCTGTGGTATGACATGTGCAAAGATTCTGCCTGCTTTTTGACAATGAA

GGAGACAGACCTGGAGGCTGTTGCAACAGCAGTCCAAAGGGTTGCTGGGATGCTTCAGCGCCCAGACCAACTGGACAAAGTGGAGCAGTATCGCAGAAGG

GAAGCTCGGAAGAAGGCCTCTGTAGAGGCCAGGCTAAAG GCTGCAATCCAGTCTCAACTAGATGGGGTACGCACAGGCTTAAGCCAACTGCACAATGCA

CTGAATGACGTCAAGGATATCCAGCAGTCACTGGCTGATGTCAGCAAGGACTGGAGGCAAAGCATCAACACCATTGAGAGTCTCAAAGATGTAAAAGATG

CAGTGGTGCAGCATAGCCAGCTGGCTGCAGCTGTGGAGAACCTCAAGAACATATTCTCAG TGCCTGAGATTGTGAGGGAGACCCAAGATCTCATCGAGC

AAGGGGCCCTCCTGCAAGCCCACCGGAAGCTAATGGATCTGGAGTGCTCTCGGGATGGGCTAATGTGTGAGCAGTACCGCATGGACAGTGGGAACAAACG

GGACATGACCCTCATTCATGGCTACTTTGGTAGCACACAGGGGCTCTCTGATGAGCTGGCTAAGCAGCTGTGGATGGTGCTGCAAAGATCACTGGTCACT

GTCCGCCGGGATCCTACCTTGCTGGTCTCCGTGGTCAGAATCATTGAAAGGGAAGAAAAAATTGACAGGCGGATACTTGATCGAAAAAAGCAAACTGGGT

TTGTTCCTCCTGGAAGGCCCAAAAACTGGAAAGAAAAAATGTTTGCCATCTTGGACAGAACTGTGACAACTAGAATCGAAGGTACACAGGCAGACACCAG

AGAATCTGACAAGATGTGGCTTGTGCGCCACCTGGAGATCATTAGGAAGTATGTCCTGGATGATCTCATTGTTGCCAAGAACCTGATGGTCCAGTGCTTC

CCTCCTCACTATGAGATCTTTAAGAACCTCCTGAGCATGTACCACCAGGCCTTGAGCACTCGGATGCAGGACCTTGCATCAGAGGACCTTGAGGCCAACG

AGATTGTGAGCCTCTTGACATGGGTCCTAAATACCTACACCAG TGCAGAGATGATGGGGAATGTGGAACTAGCCCCAGAAGTGGATGTTAGTGCCCTGG

AGCCCCTCCTCTCTCCAAACATCGTCTCCGAGCTGCTTGACACATACATGTCAACACTCACG TCCAACATCATTGCCTGGCTTCGGAAAGCACTGGAAA

CAGACAAGAAAGACTGGAGCAAAGAGACAGAGCCAGAAGCAGACCAGGATGGTTACTATCAGACTACACTTCCTGCCATTGTATTCCAG ATGTTCGAAC

AGAATCTTCAAGTTGCTGCTCAAATAAGTGAAGATTTGAAAACAAAGGTATTAGTGTTGTGTCTTCAGCAAATGAATTCTTTCCTAAGTAG ATACAAAG

ATGAAGCCCAGCTTTACAAAGAAGAGCACCTGAGAAACCGGCAACACCCACACTGTTATGTGCAGTACATGATTGCCATCATCAATAACTGCCAGACCTT

CAA AGAATCCATCATCAGTCTGAAAAGGAAGTACCTAAAAACTGAAGCAGAGGAGGGCCTGTGTCTGAGTCAGCCAAGCATGGATGGGATTCTAGACGC

CATTGCTAAGGAAGGCTGCAGCAGTCTGCTAGAGGAGGTCTTCCTGGATCTAGAG CAACATCTGAATGAGCTGATGACAAAGAAGTGGTTGTTAGGGTC

AAACGCTGTGGACATCATCTGTGTCACTGTAGAAGACTACTTCAATGACTTTGCCAAAATTAAAAAGCCATATAAAAAG - UNI21051 - AGAATGA

CAGCTGAGGCACACAGACGTGTGGTGGTGGAATACCTGCGGGCTGTCATGCAGAAGCGTATTTCCTTTCGGAGTGCTGAAGAGCGCAAGGAGGGCGCCGA

GAAGATGGTCAGAGAGGCTGAACAGCTCCGCTTCCTGTTCCGGAAGCTGGCGTCT GGATTTGGTGAGGATGCAGATGGACACTGTGATACAATTGTTGC

AGTGGCAGAGGTCATTAAGCTCACAGACCCTTCTCTGCTCTATCTAGAAGTCTCAACTCTGGTCAGCAAATATCCAGACATCAG AGATGACCACATTGG

TGCACTGCTGGCACTGCGAGGAGATGCCAGCCGGGACATGAAACAGACCATCATGGAGACGCTGGAGCAGGGCCCCATGCAAGCAAGCCCCAACTATGTA

CCCATCTTCAAGGAGATTGTTGTGCCCAGTCTGAACGTGGCAAAGCTCCTTAAGTAGCCCTGTCCTCCCTGCTGCCCTATGTGTCTTTACTGTGTGGCTT

CCCTGTTGTCACCATATTAAACCAAAAGTCCGTCTCT
Translation
 - UNI26160 - MCKDSACFLTMKETDLEAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLK AAIQSQLDGVRTGLSQLHNALNDVKDI

QQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSV VPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMCEQYRMDSGNKRDMTLI

HGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFAILDRTVTTRIEGTQADTRESDKM

WLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLSMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTS SAEMMGNVELAPEVDVSALEPLL

SPNIVSELLDTYMSTLT SNIIAWLRKALETDKKDWSKETEPEADQDGYYQTTLPAIVFQ MFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSR RYKD

EAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFK KESIISLKRKYLKTEAEEGLCLSQPSMDGILDAIAKEGCSSLLEEVFLDLE QHLNELMTKKWLL

GSNAVDIICVTVEDYFNDFAKIKKPYKK - UNI21051 - RMTAEAHRRVVVEYLRAVMQKRISFRSAEERKEGAEKMVREAEQLRFLFRKLAS GFG

EDADGHCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIR RDDHIGALLALRGDASRDMKQTIMETLEQGPMQASPNYVPIFKEIVVPSLNVAKLLK

For any suggestions or comments, please send an email to unitrap@crg.es