Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034187 (Nsf)
Chromosomal location
Chr 11: 103683099 - 103815338 (-)
Description
N-ethylmaleimide sensitive fusion protein Gene [Source:MGI (curated);Acc:Nsf-001]
RefSeq_dna
NM_008740 
RefSeq_peptide
NP_032766.2 
MGI
MGI:104560 
Uniprot/SWISSPROT
P46460 
Human Ortholog
ENSG00000073969 (NSF)
Omim not available
UniTrap UNI2801
Vector Insertion
Chr 11: 103815283 - 103815324
Public Clones AH0106 (sanger) RRN184 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32838
Vector Insertion
Chr 11: 103792389 - 103815324
Public Clones (sanger) 3SE152G01 (ggtc) 5SE152G01 (ggtc) IST10672G7 (tigm) IST12470A12 (tigm)
IST11713A10 (tigm) IST14840D7 (tigm) IST14988B9 (tigm) IST13045B12 (tigm)
IST14952C1 (tigm) IST11386C9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20061
Vector Insertion
Chr 11: 103792130 - 103792384
Public Clones not available
Private Clones OST374079 (lexicon) OST356762 (lexicon) OST356659 (lexicon) OST356323 (lexicon)
OST354443 (lexicon) OST193729 (lexicon) OST53734 (lexicon) OST36920 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16084
Vector Insertion
Chr 11: 103790158 - 103792043
Public Clones not available
Private Clones OST466738 (lexicon) OST80209 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29082
Vector Insertion
Chr 11: 103787502 - 103790057
Public Clones not available
Private Clones OST9140 (lexicon)
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24181
Vector Insertion
Chr 11: 103777987 - 103787461
Public Clones not available
Private Clones OST232011 (lexicon) OST207583 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22500
Vector Insertion
Chr 11: 103775223 - 103777819
Public Clones not available
Private Clones OST295222 (lexicon)
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9
Vector Insertion
Chr 11: 103770739 - 103771913
Public Clones GC0247 (tigem) YTA042 (baygenomics) A053E01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14848
Vector Insertion
Chr 11: 103770739 - 103774706
Public Clones PST2795-NL (escells)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32032
Vector Insertion
Chr 11: 103744055 - 103771913
Public Clones IST11653E5 (tigm) IST14728F6 (tigm) IST14714D9 (tigm) IST10903H11 (tigm)
IST10758F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4543
Vector Insertion
Chr 11: 103724649 - 103733472
Public Clones (sanger) AM0781 (sanger) RRI014 (baygenomics) XB012 (baygenomics)
Private Clones OST349097 (lexicon) OST13595 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8441
Vector Insertion
Chr 11: 103689881 - 103707687
Public Clones (sanger) RRK236 (baygenomics) 5SE284G05 (ggtc) CMHD-GT_476A8-3 (cmhd)
CMHD-GT_509C5-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 86% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18365
Vector Insertion
Chr 11: 103688639 - 103689745
Public Clones 5SE152D02 (ggtc)
Private Clones OST424892 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000103075
Sequence
AACCTGGGAGCCGGACGTGTCCGCGAAGATGGCGGGCCGG - UNI2801 - - UNI20061 - - UNI32838 - ACTATGCAAGCTGCGAGATGC

CCTACTGATGAATTATCTTTAAGCAACTGTGCGGTTGTGAACGAAAAAGATTTCCAGTCTGGCCA - UNI16084 - GCATGTGATGGTGAGGACGTC

CCCCAATCACAAGTACATATTTACGCTGAGGACCCATCCGTCAGTGGTTCCAGGATGCATCGCGTTCAGCTTGCCTCAG - UNI29082 - CGAAAAT

GGGCTGGACTTTCTATTGGACAGGACATAGAAG - UNI24181 - TTGCCTTGTATTCGTTTGACAAAGCCAAGCAGTGCATCGGCACAATGACCATC

GAGATCGACTTCCTGCAGAAGAAGAACATCGACTCCAACCCTTACGACACCGACAAGATGGCCGCCGAGTTCATCCAGCAGTTCAACAACCAGGCCTTCT

CAGTGGGGCAGCAG - UNI22500 - CTTGTCTTTAGCTTCAATGATAAGCTCTTTGGATTACTGGTGAAGGACATTGAAGCCATGGATCCCAGCATC

CTGAAGGGAGAGCCTGCATCAGGCAAAAGGCAGAAG - UNI14848 - ATTGAGGTAGGCCTGGTTGTTGGAAACAGTCAAGTTGCATTTGAAAAAGC

AGAAAATTCGTCGCTCAATCTTATCG - UNI9 - - UNI14848 - - UNI32032 - GCAAAGCTAAAACCAAGGAAAATCGCCAGTCCATCATC

AATCCCGACTGGAACTTTGAGAAAATGGGGATCGGCGGTCTGGATAAGGAGTTCTCGGACATTTTCCGAAGAGCATTTGCTTCTCGGGTGTTCCCCCCGG

AGATCGTGGAACAGATGG - UNI9 - - UNI14848 - - UNI32032 - GTTGCAAACATGTTAAAGGCATCCTGTTATACGGACCCCCTGGTTG

TGGTAAAACTCTCTTGGCTCGACAGATTGGCAAGATGCTGAATGCGAGAGAGCCCAAGGTGGTCAATGGGCCAGAAATCCTTAACAAGTATGTGGGAGAA

TCAGAGGCTAACATTCGTAAACTCTTTGCTGATGCCGAAGAGGAGCAAAGGAGG - UNI32032 - CTTGGTGCTAACAGTGGCTTGCACATCATCAT

CTTTGATGAAATCGATGCCATCTGCAAGCAGAGAGGGAGCATGGCCGGCAGCACTGGAGTGCATGACACCGTGGTCAACCAGCTGCTGTCCAAGATCGAT

GGCGTTGAGCAGCTGAACAACATCCTCGTTATCG GAATGACCAATAGACCAGATTTGATAGACGAAGCTCTCCTTCGACCCGGAAGACTGGAAGTTAAA

ATGGAGATAG GCTTGCCAGATGAGAAGGGTCGACTCCAGATCCTTCATATCCACACAGCAAGGATGAGAGGGCACCAGTTACTGTCTGCAGATGTGGAC

ATCAAGGAGCTGGCTGTGGAGACTAAGAATTTCAGTGGCGCTGAGCTGGAGGGTCTGGTGCGAGCAGCGCAGTCCACAGCCATGAACAGACATATCAAG 

- UNI4543 - GCCAGCACCAAAGTAGAAGTAGACATGGAGAAGGCAGAGAGCCTGCAGGTGACAAGAGGGGACTTCCTTGCTTCCCTGGAGAACGATA

TCAAACCA GCATTTGGCACCAACCAAGAGGATTATGCAAGTTACATTATGAATGGGATCATCAAGTGGGGTGACCCCGTGACCCGAGTCCTAGATGACG

GAGAGCTGCTGGTCCAGCAAACGAAAAACAGTGACCGGACACCACTCGTTAGTGTCCTCCTAGAAG GGCCTCCTCACAGCGGGAAGACTGCCCTGGCTG

CAAAGATTGCCGAGGAATCCAACTTCCCCTTCATCAAGATCTGCTCACCTGATAAGATGATTGGCTTCTCCGAGACAGCCAAGTGTCAGGCCATGAAGAA

G ATCTTTGATGATGCTTACAAATCTCAGCTCAGCTGTGTGGTCGTGGATGACATTGAGAGGCTGCTCG ATTATGTCCCCATTGGTCCCCGGTTCTCCA

ACCTGGTATTGCAGGCTCTTCTTGTGTTACTGAAAAAGGCGCCTCCTCAG - UNI8441 - GGCCGCAAGCTTCTTATCATCGGGACCACCAGCCGCA

AAGATGTCCTGCAGGAAATGGAGATGCTGAACGCCTTCAGCACCACCATCCACGTGCCCAACATTGCCACAGGAGAGCAGCTGCTGGAAGCTCTGGAG -

 UNI18365 - CTTTTGGGCAACTTCAAAGATAAGGAACGCACCACAATTGCTCAGCAAGTCAAAGGGAAGAAAGTCTGGATAGGAATCAAGAAGTTAC

TAATGTTGATTGAGATGTCCCTGCAG ATGGATCCTGAGTACCGTGTGAGGAAATTCTTGGCCCTCATGAGAGAAGAAGGCGC TAGTCCCCTGGACTTT

GATTGAAAACGGACTGTTTACAACAGTGACCAAGGGAAGCGACCAAGGTGCAGATGGCCTGGGATCGTCACTCCTCACACTCAAGACACTGGACTACGTG

AAGTGTCCGCCTCTCTCCACACACTCGCTCTGCATGACTAGTGCAGTGAACTCCCTCGTGCTTTTGAGATGTTCTCGTGTTCCCTGGACTGCTGGGCTTC

CCTCCCGTGCTAGCTAAGATGGTTCCTGCTTATGTGGGAGGCATGTCACACCCGTGCACGCTGCCCACACCGCGATCCCTACCACCTGCCCGAAGGTCAA

CTTCTACATGAGACCAAGAGCAAAGGTAGAGGTTCCAAGGGAGTCCCTTGGCGCTCCCCATGCTAACAGCTGTGTATCCCGCAGATTAGGTCATTGTCTG

TTCCTAAAGAACTAGGCTTTGAATATCTAAGATGCTGTTCTCAATCATTTTCAGAGATATTTCCAAGTTGCAATCAGGAGAGCTTTTCTAATCGGAAGTC

AAATCATTCCTGGGGTGGCTGTGATATGCTCTGAGTGTAATTAATTTGCTCTGTGGTAAGAGATATGCTAATCATTGCCACTTGGTAGATGCCGTTAAAA

CCTTATGAAAGATACATATGGAAATCTGTACATCCCTAAACAGAAAAAAAATTAAAATAATTTACAAGCCTCTCAATTCTAATTAGCGTCCGGCTCTAAG

TGGGTCAGTTCCTTAGGATGACGTTAGAGGCCTATTAGTGCCATCGTCTTCCTTTTCCTCAGCCTGATGACTTACAATTCATCCTCCTTGTATCTCAAGT

GATCTGTAGTGTCTGCAGCACATAAATAAAACACTACTCTCCAGCAGAACAAGCCACCCCCTAGTCCTCTCCCTCAGCCCTCGAATATCCATTCCAGCGT

ACTCAACACACCTCTTCCCGAAGAGGAACTCAGCGAGCCCTTTGGAGGGTGGTTTGCCTAATCAGTGGGTTAGAAGGAATGCAATTAGGTCGTCACGTCA

TTCGTGGAGATGAGTCTTAGGGCGCATGCCACTCTCCCCGCTGCTGCTTCAAACACAAAGACAGCCATCAGAAGCCGCCCGGGAGGCTTGCTGCCACAGG

GGCACCTGGGTGATACTCTGACACTGTCCCCACAGTAGAAGGCAAATCATCTCCTAGTCTTGCCGTCTGTATACCTTGTTTGGGGTTTTCATCCCTGGCT

TATTTTGTGGCTTTGAAAGAGTGAATTGTGTTGTGAAACTGTGATTCCCGTGGCTAGTACCGTGGTTCCCTGTCCACCACCGTGGTCCCTGTTGTCTGCA

GTTCTGCCTTTCTCCTCCCAACAAAGTCCTACATGAATTAATTTATGTTTCTTGTTCAACGAAGTTAATGTCTTGTGTTTTTGTCCAAAATTATATTGAA

AAAGATATTATATTGTGTAATGCAAATTGAAGGAATGCAATAAAGAGTAAATATACTTG
Translation
MAGR - UNI2801 - - UNI20061 - - UNI32838 - TMQAARCPTDELSLSNCAVVNEKDFQSGQ - UNI16084 - QHVMVRTSPNHKYI

FTLRTHPSVVPGCIAFSLPQ - UNI29082 - RKWAGLSIGQDIEV - UNI24181 - VALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKM

AAEFIQQFNNQAFSVGQQ - UNI22500 - LVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQK - UNI14848 - IEVGLVVGNSQVAFEKAE

NSSLNLIG - UNI9 - - UNI14848 - - UNI32032 - GKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMG - 

UNI9 - - UNI14848 - - UNI32032 - GCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRR

 - UNI32032 - LGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIG GMTNRPDLIDEALLRPGRLEVKMEIG GL

PDEKGRLQILHIHTARMRGHQLLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIK - UNI4543 - ASTKVEVDMEKAESLQVTRGDFLASL

ENDIKP AFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEG GPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAK

CQAMKK IFDDAYKSQLSCVVVDDIERLLD DYVPIGPRFSNLVLQALLVLLKKAPPQ - UNI8441 - GRKLLIIGTTSRKDVLQEMEMLNAFSTTI

HVPNIATGEQLLEALE - UNI18365 - LLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQ MDPEYRVRKFLALMREEGA ASPLDFD
Transcript ENSMUST00000040443
Sequence
TTGTGTGGTAAG - UNI20061 - ACTATGCAAGCTGCGAGATGCCCTACTGATGAATTATCTTTAAGCAACTGTGCGGTTGTGAACGAAAAAGATTT

CCAGTCTGGCCA - UNI16084 - GCATGTGATGGTGAGGACGTCCCCCAATCACAAGTACATATTTACGCTGAGGACCCATCCGTCAGTGGTTCCAG

GATGCATCGCGTTCAGCTTGCCTCAG - UNI29082 - CGAAAATGGGCTGGACTTTCTATTGGACAGGACATAGAAG - UNI24181 - TTGCCT

TGTATTCGTTTGACAAAGCCAAGCAGTGCATCGGCACAATGACCATCGAGATCGACTTCCTGCAGAAGAAGAACATCGACTCCAACCCTTACGACACCGA

CAAGATGGCCGCCGAGTTCATCCAGCAGTTCAACAACCAGGCCTTCTCAGTGGGGCAGCAG - UNI22500 - CTTGTCTTTAGCTTCAATGATAAGC

TCTTTGGATTACTGGTGAAGGACATTGAAGCCATGGATCCCAGCATCCTGAAGGGAGAGCCTGCATCAGGCAAAAGGCAGAAG - UNI14848 - ATT

GAGGTAGGCCTGGTTGTTGGAAACAGTCAAGTTGCATTTGAAAAAGCAGAAAATTCGTCGCTCAATCTTATCG - UNI9 - - UNI14848 - - UN

I32032 - GCAAAGCTAAAACCAAGGAAAATCGCCAGTCCATCATCAATCCCGACTGGAACTTTGAGAAAATGGGGATCGGCGGTCTGGATAAGGAGTT

CTCGGACATTTTCCGAAGAGCATTTGCTTCTCGGGTGTTCCCCCCGGAGATCGTGGAACAGATGG - UNI9 - - UNI14848 - - UNI32032 -

 GTTGCAAACATGTTAAAGGCATCCTGTTATACGGACCCCCTGGTTGTGGTAAAACTCTCTTGGCTCGACAGATTGGCAAGATGCTGAATGCGAGAGAGC

CCAAGGTGGTCAATGGGCCAGAAATCCTTAACAAGTATGTGGGAGAATCAGAGGCTAACATTCGTAAACTCTTTGCTGATGCCGAAGAGGAGCAAAGGAG

G - UNI32032 - CTTGGTGCTAACAGTGGCTTGCACATCATCATCTTTGATGAAATCGATGCCATCTGCAAGCAGAGAGGGAGCATGGCCGGCAGCA

CTGGAGTGCATGACACCGTGGTCAACCAGCTGCTGTCCAAGATCGATGGCGTTGAGCAGCTGAACAACATCCTCGTTATCG GAATGACCAATAGACCAG

ATTTGATAGACGAAGCTCTCCTTCGACCCGGAAGACTGGAAGTTAAAATGGAGATAG GCTTGCCAGATGAGAAGGGTCGACTCCAGATCCTTCATATCC

ACACAGCAAGGATGAGAGGGCACCAGTTACTGTCTGCAGATGTGGACATCAAGGAGCTGGCTGTGGAGACTAAGAATTTCAGTGGCGCTGAGCTGGAGGG

TCTGGTGCGAGCAGCGCAGTCCACAGCCATGAACAGACATATCAAG - UNI4543 - GCCAGCACCAAAGTAGAAGTAGACATGGAGAAGGCAGAGAG

CCTGCAGGTGACAAGAGGGGACTTCCTTGCTTCCCTGGAGAACGATATCAAACCA GCATTTGGCACCAACCAAGAGGATTATGCAAGTTACATTATGAA

TGGGATCATCAAGTGGGGTGACCCCGTGACCCGAGTCCTAGATGACGGAGAGCTGCTGGTCCAGCAAACGAAAAACAGTGACCGGACACCACTCGTTAGT

GTCCTCCTAGAAG GGCCTCCTCACAGCGGGAAGACTGCCCTGGCTGCAAAGATTGCCGAGGAATCCAACTTCCCCTTCATCAAGATCTGCTCACCTGAT

AAGATGATTGGCTTCTCCGAGACAGCCAAGTGTCAGGCCATGAAGAAG ATCTTTGATGATGCTTACAAATCTCAGCTCAGCTGTGTGGTCGTGGATGAC

ATTGAGAGGCTGCTCG ATTATGTCCCCATTGGTCCCCGGTTCTCCAACCTGGTATTGCAGGCTCTTCTTGTGTTACTGAAAAAGGCGCCTCCTCAG - 

UNI8441 - GGCCGCAAGCTTCTTATCATCGGGACCACCAGCCGCAAAGATGTCCTGCAGGAAATGGAGATGCTGAACGCCTTCAGCACCACCATCCAC

GTGCCCAACATTGCCACAGGAGAGCAGCTGCTGGAAGCTCTGGAG - UNI18365 - CTTTTGGGCAACTTCAAAGATAAGGAACGCACCACAATTGC

TCAGCAAGTCAAAGGGAAGAAAGTCTGGATAGGAATCAAGAAGTTACTAATGTTGATTGAGATGTCCCTGCAG ATGGATCCTGAGTACCGTGTGAGGAA

ATTCTTGGCCCTCATGAGAGAAGAAGGCGC TAGTCCCCTGGACTTTGATTGAAAACGGACTGTTTACAACAGTGACCAAGGGAAGCGACCAAGGTGCAG

ATGGCCTGGGATCGTCACTCCTCACACTCAAGACACTGGACTACGTGAAGTGTCCGCCTCTCTCCACACACTCGCTCTGCATGACTAGTGCAGTGAACTC

CCTCGTGCTTTTGAGATGTTCTCGTGTTCCCTGGACTGCTGGGCTTCCCTCCCGTGCTAGCTAAGATGGTTCCTGCTTATGTGGGAGGCATGTCACACCC

GTGCACGCTGCCCACACCGCGATCCCTACCACCTGCCCGAAGGTCAACTTCTACATGAGACCAAGAGCAAAGGTAGAGGTTCCAAGGGAGTCCCTTGGCG

CTCCCCATGCTAACAGCTGTGTATCCCGCAGATTAGGTCATTGTCTGTTCCTAAAGAACTAGGCTTTGAATATCTAAGATGCTGTTCTCAATCATTTTCA

GAGATATTTCCAAGTTGCAATCAGGAGAGCTTTTCTAATCGGAAGTCAAATCATTCCTGGGGTGGCTGTGATATGCTCTGAGTGTAATTAATTTGCTCTG

TGGTAAGAGATATGCTAATCATTGCCACTTGGTAGATGCCGTTAAAACCTTATGAAAGATACATATGGAAATCTGTACATCCCTAAACAGAAAAAAAATT

AAAATAATTTACAAGCCTCTCAATTCTAATTAGCGTCCGGCTCTAAGTGGGTCAGTTCCTTAGGATGACGTTAGAGGCCTATTAGTGCCATCGTCTTCCT

TTTCCTCAGCCTGATGACTTACAATTCATCCTCCTTGTATCTCAAGTGATCTGTAGTGTCTGCAGCACATAAATAAAACACTACTCTCCAGCAGAACAAG

CCACCCCCTAGTCCTCTCCCTCAGCCCTCGAATATCCATTCCAGCGTACTCAACACACCTCTTCCCGAAGAGGAACTCAGCGAGCCCTTTGGAGGGTGGT

TTGCCTAATCAGTGGGTTAGAAGGAATGCAATTAGGTCGTCACGTCATTCGTGGAGATGAGTCTTAGGGCGCATGCCACTCTCCCCGCTGCTGCTTCAAA

CACAAAGACAGCCATCAGAAGCCGCCCGGGAGGCTTGCTGCCACAGGGGCACCTGGGTGATACTCTGACACTGTCCCCACAGTAGAAGGCAAATCATCTC

CTAGTCTTGCCGTCTGTATACCTTGTTTGGGGTTTTCATCCCTGGCTTATTTTGTGGCTTTGAAAGAGTGAATTGTGTTGTGAAACTGTGATTCCCGTGG

CTAGTACCGTGGTTCCCTGTCCACCACCGTGGTCCCTGTTGTCTGCAGTTCTGCCTTTCTCCTCCCAACAAAGTCCTACATGAATTAATTTATGTTTCTT

GTTCAACGAAGTTAATGTCTTGTGTTTTTGTCCAAAATTATATTGAAAAAGATATTATATTGTGTAATGCAAATTGAAGGAATGCAATAAAGAGTAAATA

TACTTG
Translation
LCGK - UNI20061 - TMQAARCPTDELSLSNCAVVNEKDFQSGQ - UNI16084 - QHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQ - UN

I29082 - RKWAGLSIGQDIEV - UNI24181 - VALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNNQAFSVGQQ - UNI2

2500 - LVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQK - UNI14848 - IEVGLVVGNSQVAFEKAENSSLNLIG - UNI9 - - UNI14

848 - - UNI32032 - GKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPEIVEQMG - UNI9 - - UNI14848 - - UNI

32032 - GCKHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVVNGPEILNKYVGESEANIRKLFADAEEEQRR - UNI32032 - LGANSGLHIII

FDEIDAICKQRGSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIG GMTNRPDLIDEALLRPGRLEVKMEIG GLPDEKGRLQILHIHTARMRGHQLLSA

DVDIKELAVETKNFSGAELEGLVRAAQSTAMNRHIK - UNI4543 - ASTKVEVDMEKAESLQVTRGDFLASLENDIKP AFGTNQEDYASYIMNGII

KWGDPVTRVLDDGELLVQQTKNSDRTPLVSVLLEG GPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKK IFDDAYKSQLSCVVVDDI

ERLLD DYVPIGPRFSNLVLQALLVLLKKAPPQ - UNI8441 - GRKLLIIGTTSRKDVLQEMEMLNAFSTTIHVPNIATGEQLLEALE - UNI183

65 - LLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQ MDPEYRVRKFLALMREEGA ASPLDFD
Transcript ENSMUST00000107009
Sequence
AGAGTGCGGAGCTGCAACCTGGGAGCCGGACGTGTCCGCGAAGATGGCGGGCCGG - UNI2801 - - UNI32838 - GTTTCTGTTGATGCCATTT

AGAGTGGAAAGCCTTTATGCAGTTGTGTG - UNI20061 - - UNI32838 - ACTATGCAAGCTGCGAGATGCCCTACTGATGAATTATCTTTAAG

CAACTGTGCGGTTGTGAACGAAAAAGATTTCCAGTCTGGCCA - UNI16084 - GCATGTGATGGTGAGGACGTCCCCCAATCACAAGTACATATTTA

CGCTGAGGACCCATCCGTCAGTGGTTCCAGGATGCATCGCGTTCAGCTTGCCTCAG - UNI29082 - CGAAAATGGGCTGGACTTTCTATTGGACAG

GACATAGAAG - UNI24181 - TTGCCTTGTATTCGTTTGACAAAGCCAAGCAGTGCATCGGCACAATGACCATCGAGATCGACTTCCTGCAGAAGAA

GAACATCGACTCCAACCCTTACGACACCGACAAGATGGCCGCCGAGTTCATCCAGCAGTTCAACAACCAGGCCTTCTCAGTGGGGCAGCAG - UNI225

00 - CTTGTCTTTAGCTTCAATGATAAGCTCTTTGGATTACTGGTGAAGGACATTGAAGCCATGGATCCCAGCATCCTGAAGGGAGAGCCTGCATCAGG

CAAAAGGCAGAAG - UNI14848 - ATTGAGGTAGGCCTGGTTGTTGGAAACAGTCAAGTTGCATTTGAAAAAGCAGAAAATTCGTCGCTCAATCTTA

TCG - UNI9 - - UNI14848 - - UNI32032 - GCAAAGCTAAAACCAAGGAAAATCGCCAGTCCATCATCAATCCCGACTGGAACTTTGAGAA

AATGGGGATCGGCGGTCTGGATAAGGAGTTCTCGGACATTTTCCGAAGAGCATTTGCTTCTCGGGTGTTCCCCCCGGAGATCGTGGAACAGATGGGTGAG

TTTCTGACCAAGCCTTCCGCTCCCGGGGAAGCACGGAGGTAATGAGGTGCTCTTCTCAAGAGTTTTGAAGTGACTTTTCAAATCCACCCAAAACAAAAAA

CAAACAAACAAAAAAAACCCAAACCATTAGGTTTCACGAGAAATTCAAAGTATTTACTCTCGTGGGAGAAATAATAGAAATGGTATTTACACTTGCTCCA

TTGTATCTGTTTAGGTTACATTGTTTTTCCGTGGGCATTTTAGAAATGGTCCCCCATCCTGAAGACCCACCCTGGGTCAGGTTCACCTGACATATTGTCG

TCGTCCATGCAGCTGAGGACATTGCACGGATGCTGGCTTACAGCCGCGCTCAGCACTTCCCTCCAGTAAATGGATACTTGGCAAGGGTTTTAATTAGATA

AGTCTGATCCCTAGAGACACATATGGGAGTCTCCATACTGCACGTGAAGAAATACTCTCTTCATTTGTCACTTTGCTCTTGACAGTTTATTTAATTTATC

CGTATGAAGTGATTTTCTTTGCCCAGTAGAAAGACCTTCAGGACAGTTTTCAAATCCGTATCATTGGTTGGATTGGAGCGTGAGCCGCAGAGTATCTGAG

AAAGGAATTTATAATAGCTTCTTGCAGACTGAGTGTGAAAACAGGATCCAAAAAGCTGGAGGGATACACACGTACTGCTCCCCTCTCCCCCATTCTCTCT

CTTTAAATTGCTACCGGGAGATAAGAGTATATTCATCACGGTGGACAAGGGGTGCTCTCCAGGCACGAAGCGCCGGGTCACAGTAGCCGGCTGTGTCTTA

GCCGGCTCTGTCGGTCTCTTTTCTGCCCGGTTGCTCACTCTGGTCAATTACGAGCACAGCACACACCTGTTCACTGGGTAAAGGTCGAGTTTAGAATTGG

ATTAAGACAAAATGACAGAGACCCTCATCACCTGAGTTTTATACACCTTGAAATGGCAGTGACATACTTCTTATCTGGAAGATACAAAGGCCAAATCCAT

AAAAAGAAAAGG
Translation
 - UNI2801 - - UNI32838 -  - UNI20061 - - UNI32838 - MQAARCPTDELSLSNCAVVNEKDFQSGQ - UNI16084 - QHVMV

RTSPNHKYIFTLRTHPSVVPGCIAFSLPQ - UNI29082 - RKWAGLSIGQDIEV - UNI24181 - VALYSFDKAKQCIGTMTIEIDFLQKKNID

SNPYDTDKMAAEFIQQFNNQAFSVGQQ - UNI22500 - LVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQK - UNI14848 - IEVGLVVGN

SQVAFEKAENSSLNLIG - UNI9 - - UNI14848 - - UNI32032 - GKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIFRRAFASRVFPPE

IVEQMGEFLTKPSAPGEARR

For any suggestions or comments, please send an email to unitrap@crg.es