Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034274 (Thoc5)
Chromosomal location
Chr 11: 4795323 - 4828870 (+)
Description
THO complex 5 Gene [Source:MGI (curated);Acc:Thoc5-001]
RefSeq_dna
NM_172438 
RefSeq_peptide
NP_766026.1 
UniGene
Mm.28969 
MGI
MGI:1351333 
Uniprot/SWISSPROT
Q8BKT7 
Uniprot/SPTREMBL
Q5SVF9 Q5SVF8 
Human Ortholog
ENSG00000100296 (THOC5)
Omim not available
UniTrap UNI19691
Vector Insertion
Chr 11: 4795382 - 4799793
Public Clones D181H04 (ggtc) IST14493C1 (tigm) IST10453A11 (tigm) IST12243B6 (tigm)
Private Clones OST383515 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16142
Vector Insertion
Chr 11: 4799793 - 4799910
Public Clones not available
Private Clones OST466092 (lexicon) OST212446 (lexicon) OST146357 (lexicon) OST54756 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13314
Vector Insertion
Chr 11: 4799910 - 4801154
Public Clones CMHD-GT_335G9-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26551
Vector Insertion
Chr 11: 4799910 - 4801154
Public Clones not available
Private Clones OST111125 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25485
Vector Insertion
Chr 11: 4801299 - 4802088
Public Clones not available
Private Clones OST181776 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23881
Vector Insertion
Chr 11: 4802203 - 4802337
Public Clones not available
Private Clones OST241657 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33655
Vector Insertion
Chr 11: 4805759 - 4810629
Public Clones IST10368G5 (tigm) IST12872A6 (tigm) IST10436F9 (tigm) IST13562H3 (tigm)
IST14522F5 (tigm) IST11956H3 (tigm) IST13677E8 (tigm) IST14889D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000101615
Sequence
TTCTCTATGGTCGCGAGCCGGAAGTGGCTACCCGGCTGGAAGGCGTGAGGAGCATTCTG - UNI16142 - - UNI19691 - CCTTTTCACCTGGA

AGCACAATGTCATCAGAATCCAGCAAAAAACGGAAACCCAAAGTGATCCGGAGTGATGGAACCCCAACTGAAGGGAAACGGAACCGGTCTGACACGGAGC

AG - UNI13314 - - UNI16142 - - UNI25485 - - UNI26551 - GCCATTGAAATTGAAGAACGAAGGATCCAGAGCTGTGTGCACTTC

ATGACTCTAAAGAAGCTTAACCGATTAGCCCACATCAGATTAAAGAAAGGAAGAGACCAGACCCACGAG - UNI23881 - GCCAAGCAGAAAGTCGA

TGCCTACCACCTACAGCTACAGAACCTGCTCTACGAAGTGATGCACCTGCAGAAGGAGATCACCAAATGTCTGGAGTTCAA GTCAAAGCATGAAGAAAT

TGATCTGGTCAGCTTAGAGGAATTTTATTCAGAGGCTCCACCAAGCATCAGCAAGGCCGAGATCACCATGGGAGACCCTCACCAACAAACATTGGCACGT

TTGGACTGGGAGCTGGAGCAGCGGAAAAG GCTGGCAGAAAAGTACCGAGAATGTCTGTCTAACAAGGAGAAGATCCTGAAGGAGATTGAGGTGAAGAGG

GACTATCTGAGCAGCCTCCAGCCTCGCCTCAACAGCATCATGCAG - UNI33655 - GCTTCCCTGCCAGTGCAAGAATACCTGTTCATGCCATTTGA

CCAGGCGCACAAACAGTATGAGACTGCCAGGCACCTGCCGCCTCCCCTCTATGTGCTCTTTGTGCAGGCCACTGCATACGGGCAGGCCTGTG ATAAGAC

GCTGTCCGTGGCAATTGAAGGCAGTGTGGACGAAGCCAAAGCTCTTTTCAAGCCCCCTGAGGACTCCCAAG ATGATGAGAGCGACTCAGATGCTGAAGA

GGAGCAGACGACG AAGCGGCGGCGGCCCACTCTCGGGGTTCAGTTGGATGACAAGCGCAAGGAGATGCTAAAAAGGCACCCACTGTCTGTCCTGCTGGA

TCTGAAGTGCAAAG ACAACAGTGTGCTTCATCTGACTTTCTACTATCTCATGAACCTCAACATCATGACAGTGAAAGCCAAAGTGACGACCGCCGTGGA

GCTGATCACCCCCATCAGTGCAGG AGACTTACTGTCTCCTGACTCGGTCTTGAGCTGCTTGTATCCGGGAGATCATGGGAAAAAAACTCCAAATCCAGC

CAATCAGTATCAGTTTGACAAAGTTGG CATCCTGACTTTGAGAGACTATGTACTTGAGTTAGGTCACCCCTACTTGTGGGTACAGAAGCTGGGTGGCCT

CCACTTCCCCAAAGAGCAGCCCCAG CAAACAGTGATGCCTGACCACTCACAGAGCGCCAGCCACATGGAGACCACCATGAAACTGCTGAAGACCAGGGT

ACAGTCCCGCCTGGCTCTCCACAAACAGTTTGCATCTCTGG AACATGGCATTGTGCCCGTCACCAGCGATTGCCAGGACCTCTTCCCTGCCAAGGTTGT

TTCTCGCCTGGTAAAGTGGGTGATAATTACCCATGAAGATTACATG GAGCTGCACTTCACTAAGGACATTGTGGAGGCAGGACTGGCCGGAGACACCAA

TCTCTACTACCTGGCGCTAATTGAAAGGGGAACAG CTAAACTTCAGGCTGCTGTGGTACTAAACCCTGGCTACTCCTCCATCCCACCGGTTTTCCGACT

CTGTCTAAACTGGAAAGGGGAGAAAACCAACAGCAACGATGACAATATTCGG GCTATGGAGAGTGAAGTCAACGTGTGCTATAAGGAGTTGTGTGGCCC

TCGGCCCAGTCACCAGCTCCTGACCAACCAGCTGCAGAGACTGTGTGTGCTGCTGGACGTCTACCTGGAGACCGAGAGCCACGATGACAGCTTCGAGGGC

CCCAAGGAGTTTCCCCAGGAGAAGATGTGCCTGCGGCTTTTTAG GGGTCCGAGTAGGATGAAGCCGTTTAAATACAACCATCCCCAAGGGTTCTTCAGC

CACCGCTGACTCCCCTCGACTTGTCATTCCCCAAAGCCCTGTCCTGGCTCCTGGGTATCTGCTTTTTGCTTTGGCCACATGTGGTTCTTGATATTTTCCA

AAGACACCAGCTAATTAAAATGTCATCTGACAAATGGA
Translation
 - UNI16142 - - UNI19691 - MSSESSKKRKPKVIRSDGTPTEGKRNRSDTEQ - UNI13314 - - UNI16142 - - UNI25485 - -

 UNI26551 - AIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHE - UNI23881 - AKQKVDAYHLQLQNLLYEVMHLQKEITKCLEFK KS

KHEEIDLVSLEEFYSEAPPSISKAEITMGDPHQQTLARLDWELEQRKR RLAEKYRECLSNKEKILKEIEVKRDYLSSLQPRLNSIMQ - UNI33655 

- ASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQACD DKTLSVAIEGSVDEAKALFKPPEDSQD DDESDSDAEEEQTT KRRRPTLGV

QLDDKRKEMLKRHPLSVLLDLKCKD DNSVLHLTFYYLMNLNIMTVKAKVTTAVELITPISAG GDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVG 

GILTLRDYVLELGHPYLWVQKLGGLHFPKEQPQ QTVMPDHSQSASHMETTMKLLKTRVQSRLALHKQFASLE EHGIVPVTSDCQDLFPAKVVSRLVKW

VIITHEDYM ELHFTKDIVEAGLAGDTNLYYLALIERGTA AKLQAAVVLNPGYSSIPPVFRLCLNWKGEKTNSNDDNIR AMESEVNVCYKELCGPRPS

HQLLTNQLQRLCVLLDVYLETESHDDSFEGPKEFPQEKMCLRLFR RGPSRMKPFKYNHPQGFFSHR
Transcript ENSMUST00000038237
Sequence
GTGGCTACCCGGCTGGAAGGCGTGAGGAGCATTCTG - UNI16142 - - UNI19691 - CCTTTTCACCTGGAAGCACAATGTCATCAGAATCCAG

CAAAAAACGGAAACCCAAAGTGATCCGGAGTGATGGAACCCCAACTGAAGGGAAACGGAACCGGTCTGACACGGAGCAG - UNI13314 - - UNI16

142 - - UNI26551 - GAAGGCAAATACTACAGTGAGGAGGCTGAAGTTGACCTGCGGGACCCTGGCAGAGACTATGAGTTGTACAAATACACTTGC

CAGGAGCTACAAAGGCTGATGGCCGAGATCCAGGACCTGAAGAGTAAGGGCAGCAAGGACCTG - UNI25485 - GCCATTGAAATTGAAGAACGAAG

GATCCAGAGCTGTGTGCACTTCATGACTCTAAAGAAGCTTAACCGATTAGCCCACATCAGATTAAAGAAAGGAAGAGACCAGACCCACGAG - UNI238

81 - GCCAAGCAGAAAGTCGATGCCTACCACCTACAGCTACAGAACCTGCTCTACGAAGTGATGCACCTGCAGAAGGAGATCACCAAATGTCTGGAGTT

CAA GTCAAAGCATGAAGAAATTGATCTGGTCAGCTTAGAGGAATTTTATTCAGAGGCTCCACCAAGCATCAGCAAGGCCGAGATCACCATGGGAGACCC

TCACCAACAAACATTGGCACGTTTGGACTGGGAGCTGGAGCAGCGGAAAAG GCTGGCAGAAAAGTACCGAGAATGTCTGTCTAACAAGGAGAAGATCCT

GAAGGAGATTGAGGTGAAGAGGGACTATCTGAGCAGCCTCCAGCCTCGCCTCAACAGCATCATGCAG - UNI33655 - GCTTCCCTGCCAGTGCAAG

AATACCTGTTCATGCCATTTGACCAGGCGCACAAACAGTATGAGACTGCCAGGCACCTGCCGCCTCCCCTCTATGTGCTCTTTGTGCAGGCCACTGCATA

CGGGCAGGCCTGTG ATAAGACGCTGTCCGTGGCAATTGAAGGCAGTGTGGACGAAGCCAAAGCTCTTTTCAAGCCCCCTGAGGACTCCCAAG ATGATG

AGAGCGACTCAGATGCTGAAGAGGAGCAGACGACG AAGCGGCGGCGGCCCACTCTCGGGGTTCAGTTGGATGACAAGCGCAAGGAGATGCTAAAAAGGC

ACCCACTGTCTGTCCTGCTGGATCTGAAGTGCAAAG ACAACAGTGTGCTTCATCTGACTTTCTACTATCTCATGAACCTCAACATCATGACAGTGAAAG

CCAAAGTGACGACCGCCGTGGAGCTGATCACCCCCATCAGTGCAGG AGACTTACTGTCTCCTGACTCGGTCTTGAGCTGCTTGTATCCGGGAGATCATG

GGAAAAAAACTCCAAATCCAGCCAATCAGTATCAGTTTGACAAAGTTGG CATCCTGACTTTGAGAGACTATGTACTTGAGTTAGGTCACCCCTACTTGT

GGGTACAGAAGCTGGGTGGCCTCCACTTCCCCAAAGAGCAGCCCCAG CAAACAGTGATGCCTGACCACTCACAGAGCGCCAGCCACATGGAGACCACCA

TGAAACTGCTGAAGACCAGGGTACAGTCCCGCCTGGCTCTCCACAAACAGTTTGCATCTCTGG AACATGGCATTGTGCCCGTCACCAGCGATTGCCAGG

ACCTCTTCCCTGCCAAGGTTGTTTCTCGCCTGGTAAAGTGGGTGATAATTACCCATGAAGATTACATG GAGCTGCACTTCACTAAGGACATTGTGGAGG

CAGGACTGGCCGGAGACACCAATCTCTACTACCTGGCGCTAATTGAAAGGGGAACAG CTAAACTTCAGGCTGCTGTGGTACTAAACCCTGGCTACTCCT

CCATCCCACCGGTTTTCCGACTCTGTCTAAACTGGAAAGGGGAGAAAACCAACAGCAACGATGACAATATTCGG GCTATGGAGAGTGAAGTCAACGTGT

GCTATAAGGAGTTGTGTGGCCCTCGGCCCAGTCACCAGCTCCTGACCAACCAGCTGCAGAGACTGTGTGTGCTGCTGGACGTCTACCTGGAGACCGAGAG

CCACGATGACAGCTTCGAGGGCCCCAAGGAGTTTCCCCAGGAGAAGATGTGCCTGCGGCTTTTTAG GGGTCCGAGTAGGATGAAGCCGTTTAAATACAA

CCATCCCCAAGGGTTCTTCAGCCACCGCTGACTCCCCTCGACTTGTCATTCCCCAAAGCCCTGTCCTGGCTCCTGGGTATCTGCTTTTTGCTTTGGCCAC

ATGTGGTTCTTGATATTTTCCAAAGACACCAGCTAATTAAAATGTCATCTGACAAATG
Translation
 - UNI16142 - - UNI19691 - MSSESSKKRKPKVIRSDGTPTEGKRNRSDTEQ - UNI13314 - - UNI16142 - - UNI26551 - E

GKYYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQDLKSKGSKDL - UNI25485 - AIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHE 

- UNI23881 - AKQKVDAYHLQLQNLLYEVMHLQKEITKCLEFK KSKHEEIDLVSLEEFYSEAPPSISKAEITMGDPHQQTLARLDWELEQRKR RL

AEKYRECLSNKEKILKEIEVKRDYLSSLQPRLNSIMQ - UNI33655 - ASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQACD DKT

LSVAIEGSVDEAKALFKPPEDSQD DDESDSDAEEEQTT KRRRPTLGVQLDDKRKEMLKRHPLSVLLDLKCKD DNSVLHLTFYYLMNLNIMTVKAKVT

TAVELITPISAG GDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVG GILTLRDYVLELGHPYLWVQKLGGLHFPKEQPQ QTVMPDHSQSASHMETT

MKLLKTRVQSRLALHKQFASLE EHGIVPVTSDCQDLFPAKVVSRLVKWVIITHEDYM ELHFTKDIVEAGLAGDTNLYYLALIERGTA AKLQAAVVLN

PGYSSIPPVFRLCLNWKGEKTNSNDDNIR AMESEVNVCYKELCGPRPSHQLLTNQLQRLCVLLDVYLETESHDDSFEGPKEFPQEKMCLRLFR RGPSR

MKPFKYNHPQGFFSHR
Transcript ENSMUST00000109903
Sequence
GTGGCTACCCGGCTGGAAGGCGTGAGGAGCATTCTG - UNI16142 - - UNI19691 - CCTTTTCACCTGGAAGCACAATGTCATCAGAATCCAG

CAAAAAACGGAAACCCAAAGTGATCCGGAGTGATGGAACCCCAACTGAAGGGAAACGGAACCGGTCTGACACGGAGCAG - UNI13314 - - UNI16

142 - - UNI26551 - GAAGGCAAATACTACAGTGAGGAGGCTGAAGTTGACCTGCGGGACCCTGGCAGAGACTATGAGTTGTACAAATACACTTGC

CAGGAGCTACAAAGGCTGATGGCCGAGATCCAGGACCTGAAGAGTAAGGGCAGCAAGGACCTG - UNI25485 - GCCATTGAAATTGAAGAACGAAG

GATCCAGAGCTGTGTGCACTTCATGACTCTAAAGAAGCTTAACCGATTAGCCCACATCAGATTAAAGAAAGGAAGAGACCAGACCCACGAG - UNI238

81 - GCCAAGCAGAAAGTCGATGCCTACCACCTACAGCTACAGAACCTGCTCTACGAAGTGATGCACCTGCAGAAGGAGATCACCAAATGTCTGGAGTT

CAA GTCAAAGCATGAAGAAATTGATCTGGTCAGCTTAGAGGAATTTTATTCAGAGGCTCCACCAAGCATCAGCAAGGCCGAGATCACCATGGGAGACCC

TCACCAACAAACATTGGCACGTTTGGACTGGGAGCTGGAGCAGCGGAAAAG GCTGGCAGAAAAGTACCGAGAATGTCTGTCTAACAAGGAGAAGATCCT

GAAGGAGATTGAGGTGAAGAGGGACTATCTGAGCAGCCTCCAGCCTCGCCTCAACAGCATCATGCAG - UNI33655 - GCTTCCCTGCCAGTGCAAG

AATACCTGTTCATGCCATTTGACCAGGCGCACAAACAGTATGAGACTGCCAGGCACCTGCCGCCTCCCCTCTATGTGCTCTTTGTGCAGGCCACTGCATA

CGGGCAGGCCTGTG CTCATATGAAATCCTCCTCCCAGCCCCCTAGACAGG ATAAGACGCTGTCCGTGGCAATTGAAGGCAGTGTGGACGAAGCCAAAG

CTCTTTTCAAGCCCCCTGAGGACTCCCAAG ATGATGAGAGCGACTCAGATGCTGAAGAGGAGCAGACGACG AAGCGGCGGCGGCCCACTCTCGGGGTT

CAGTTGGATGACAAGCGCAAGGAGATGCTAAAAAGGCACCCACTGTCTGTCCTGCTGGATCTGAAGTGCAAAG ACAACAGTGTGCTTCATCTGACTTTC

TACTATCTCATGAACCTCAACATCATGACAGTGAAAGCCAAAGTGACGACCGCCGTGGAGCTGATCACCCCCATCAGTGCAGG AGACTTACTGTCTCCT

GACTCGGTCTTGAGCTGCTTGTATCCGGGAGATCATGGGAAAAAAACTCCAAATCCAGCCAATCAGTATCAGTTTGACAAAGTTGG CATCCTGACTTTG

AGAGACTATGTACTTGAGTTAGGTCACCCCTACTTGTGGGTACAGAAGCTGGGTGGCCTCCACTTCCCCAAAGAGCAGCCCCAG CAAACAGTGATGCCT

GACCACTCACAGAGCGCCAGCCACATGGAGACCACCATGAAACTGCTGAAGACCAGGGTACAGTCCCGCCTGGCTCTCCACAAACAGTTTGCATCTCTGG

 AACATGGCATTGTGCCCGTCACCAGCGATTGCCAGGACCTCTTCCCTGCCAAGGTTGTTTCTCGCCTGGTAAAGTGGGTGATAATTACCCATGAAGATT

ACATG GAGCTGCACTTCACTAAGGACATTGTGGAGGCAGGACTGGCCGGAGACACCAATCTCTACTACCTGGCGCTAATTGAAAGGGGAACAG CTAAA

CTTCAGGCTGCTGTGGTACTAAACCCTGGCTACTCCTCCATCCCACCGGTTTTCCGACTCTGTCTAAACTGGAAAGGGGAGAAAACCAACAGCAACGATG

ACAATATTCGG GCTATGGAGAGTGAAGTCAACGTGTGCTATAAGGAGTTGTGTGGCCCTCGGCCCAGTCACCAGCTCCTGACCAACCAGCTGCAGAGAC

TGTGTGTGCTGCTGGACGTCTACCTGGAGACCGAGAGCCACGATGACAGCTTCGAGGGCCCCAAGGAGTTTCCCCAGGAGAAGATGTGCCTGCGGCTTTT

TAG GGGTCCGAGTAGGATGAAGCCGTTTAAATACAACCATCCCCAAGGGTTCTTCAGCCACCGCTGACTCCCCTCGACTTGTCATTCCCCAAAGCCCTG

TCCTGGCTCCTGGGTATCTGCTTTTTGCTTTGGCCACATGTGGTTCTTGATATTTTCCAAAGACACCAGCTAATTAAAATGTCATCTGACAAATG
Translation
 - UNI16142 - - UNI19691 - MSSESSKKRKPKVIRSDGTPTEGKRNRSDTEQ - UNI13314 - - UNI16142 - - UNI26551 - E

GKYYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQDLKSKGSKDL - UNI25485 - AIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHE 

- UNI23881 - AKQKVDAYHLQLQNLLYEVMHLQKEITKCLEFK KSKHEEIDLVSLEEFYSEAPPSISKAEITMGDPHQQTLARLDWELEQRKR RL

AEKYRECLSNKEKILKEIEVKRDYLSSLQPRLNSIMQ - UNI33655 - ASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQACA AHM

KSSSQPPRQD DKTLSVAIEGSVDEAKALFKPPEDSQD DDESDSDAEEEQTT KRRRPTLGVQLDDKRKEMLKRHPLSVLLDLKCKD DNSVLHLTFYY

LMNLNIMTVKAKVTTAVELITPISAG GDLLSPDSVLSCLYPGDHGKKTPNPANQYQFDKVG GILTLRDYVLELGHPYLWVQKLGGLHFPKEQPQ QTV

MPDHSQSASHMETTMKLLKTRVQSRLALHKQFASLE EHGIVPVTSDCQDLFPAKVVSRLVKWVIITHEDYM ELHFTKDIVEAGLAGDTNLYYLALIER

GTA AKLQAAVVLNPGYSSIPPVFRLCLNWKGEKTNSNDDNIR AMESEVNVCYKELCGPRPSHQLLTNQLQRLCVLLDVYLETESHDDSFEGPKEFPQE

KMCLRLFR RGPSRMKPFKYNHPQGFFSHR

For any suggestions or comments, please send an email to unitrap@crg.es