Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034285 (Nipsnap1)
Chromosomal location
Chr 11: 4774006 - 4794203 (+)
Description
4-nitrophenylphosphatase domain and non-neuronal SNAP25-like protein homolog 1 (C. elegans) Gene [Source:MGI (curated);Acc:Nipsnap1-001]
RefSeq_dna
NM_008698 
RefSeq_peptide
NP_032724.1 
UniGene
Mm.293716 
MGI
MGI:1278344 
Uniprot/SWISSPROT
O55125 
Uniprot/SPTREMBL
Q5SVG6 Q3UGS1 Q5SVF7 
Human Ortholog
ENSG00000184117 (NIPSNAP1)
Omim not available
UniTrap UNI29663
Vector Insertion
Chr 11: 4774107 - 4782971
Public Clones (sanger) E123F02 (ggtc) IST12739H9 (tigm) IST12016H1 (tigm) IST13652G11 (tigm)
IST11387G6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20908
Vector Insertion
Chr 11: 4783257 - 4783370
Public Clones (sanger)
Private Clones OST348536 (lexicon) OST287281 (lexicon) OST283241 (lexicon) OST280683 (lexicon)
OST260920 (lexicon) OST118084 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23715
Vector Insertion
Chr 11: 4783499 - 4783728
Public Clones CMHD-GT_418F2-3 (cmhd)
Private Clones OST248083 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17534
Vector Insertion
Chr 11: 4783775 - 4784024
Public Clones not available
Private Clones OST440986 (lexicon) OST286383 (lexicon) OST273799 (lexicon) OST216781 (lexicon)
OST210328 (lexicon) OST33384 (lexicon)
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI24295
Vector Insertion
Chr 11: 4784120 - 4788882
Public Clones IST11324F5 (tigm)
Private Clones OST225522 (lexicon)
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23850
Vector Insertion
Chr 11: 4789241 - 4789535
Public Clones not available
Private Clones OST242569 (lexicon)
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093371
Sequence
ATGGTGTGTTGCTTAGGAAGCTCCTGCTGTGAAAT - UNI20908 - CTTCTATTCCAAGGACAGTGAAGGAAGCTGGTTCCGTTCCCTCTTTGTCCA

CAAGGTGGATCCTCGGAAGGACGCCCACTCCACTCTGCTGTCCAAGAAGGAGACTAGTAATCTCTACAAGATCCAGT - UNI23715 - TTCACAACG

TGAAGCCCGAATGTCTGGATGCCTACAACAGTCTGAC - UNI17534 - GGAGGCTGTACTGCCCAAGCTGCACCTGGATGAGGACTATCCCTGCTCG

CTTGTGGGCAACTGGAACACGTGGTACGGGGAGCAGGACCAGGCAG - UNI24295 - TACACCTATGGCGGTTCTCAGGTGGCTACCCGGCCCTCAT

GGACTGCATGAACAAGCTAAAAAACAACAAG GAGTACCTGGAGTTCCGGAAGGAACGGAGCAAGATGCTGCTGTCCAGGAGAAACCAGTTGCTTCTGGA

GTTCAGCTTCTGGAATGAGCCACAGCCCCGAGCTGGCCCCAATATCTATGAGCTGAGGACATATAAACTCAAG - UNI23850 - CCAGGAACCATGA

TTGAATGGGGAAACAACTG GGCTCGGGCCATCAAGTACCGTCAGGAGAACCAGGAGGCGGTGGGAGGCTTCTTTTCACAAATAGGAGAGCTCTACGTGG

TACACCACTTATGGG CCTACAAAGATTTGCAATCTCGGGAGGAGACTCGAAATGCGGCCTGGAGAAAGAGGGGCTGGGATGAAAATGTCTACTACACAG

 TCCCCTTGGTTCGACACATGGAGTCACGAATCATGATTCCTCTGAAGATTTCTCCTCTCCAGTGAAGCTGGCACTGCCTCCACCTCCTTCCCTTTCTCC

TGTGGACTAGCCTGGAAAGGAGGCGCTTCTAGGCCACCTGGCACAGTTTTCTCTGAACTCTGGAAGACTTCTGATGGGTGGTGTTCAGCTTCGACAAAGA

TGACGTTTTCTGAGAACTTAGTCCGTCCGTACCCAGCTAACCTCTCTCCCATGCTGGATGAAGAAGTTCTTAACTTCCCAAGCTGCAGAATAGCAACCTT

TTAAGCTTTCACACACTTTCCTCTTAAGATCCGTCATCTCCAGGACATAAGTCCCCAGCTCCCAACTGTGGCCATGGCTTAGTTGCATAAAAGCAGGCAT

GACTGGCTGTTAGGAGGTATGGTGTGAAAGGGTATCAGTCCAGGTATGGCCCGGGAACTCTCTGGTGTCTACTTGTTAAAAAAGCAAGCCTGAGTCTTTA

AAAAAAAATAAATAAAAATCCTGGAACTGCCATAAAGTCTGAAGTCGTGACAGTCAGGAGGAAATCCAGAAGTTATCAGTGTCAGTAGGTGGTCCAGAAG

TCTACTTAAAGGGCTAGGAAAAGGGTGGGAGTGGGAAGGATCTGGGTACATGAGACAGCCTTGAAGCAGGAACCCTTCACAAGTGGGCACATAGGATTCA

GAATTTAAAATACAGAATTGGGAAGACAGGACAGAGGTGACAGAGGATCTTAAGGGAGCACCCTGTTCCTAGACAGATGGAGAGGCGTATCCATGTTTTC

CTACATAATGTGGTTAAAACTTGAATTTGTGCTTCAGCTCTTCTGTACTTCTTCCTTCCTACAGGCAAAAACACAGGCTGAGACCTATAGTTCCATCAAA

TTCTTTCTTTCCCTTCTTGACATTGTCCCCCAAACCCTCATTTTGCAGAAACACTAGGTCTGTGGAGTAGGTTGTGATTCTGGGGTCTCTTCAATGACCC

CGGTACCTCATGAACCCCTGCTTAGCATGGTTGTGCTACCATCCAGGAGAATGTTGATGGAACCAAATTAAATATTTACTGT
Translation
MVCCLGSSCCEI - UNI20908 - IFYSKDSEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLYKIQF - UNI23715 - FHNVKPECLDAYNSLT

 - UNI17534 - TEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAV - UNI24295 - VHLWRFSGGYPALMDCMNKLKNNK EYLEFRKERSK - 

UNI23850 -    
Transcript ENSMUST00000093370
Sequence
ATGAGTTACTGCGAGCCTAGCTCTGGAGCAAAGGTCTGGGTGGCCGAGTGGAGCCGCTTTTCTGCATGTTACTACCTCCTCCTGGGACAGCAGCCGTGTC

CATTCAGAGCAAAGGCCACACCCTTCGGTGCCCCACTTGAGGGGCTGGTTTTCAAGTGCTGTTCTCCGATTTGTCCTTATGACCCTTGGAAGTTGCTTAA

ACA - UNI20908 - CTTCTATTCCAAGGACAGTGAAGGAAGCTGGTTCCGTTCCCTCTTTGTCCACAAGGTGGATCCTCGGAAGGACGCCCACTCCA

CTCTGCTGTCCAAGAAGGAGACTAGTAATCTCTACAAGATCCAGT - UNI23715 - TTCACAACGTGAAGCCCGAATGTCTGGATGCCTACAACAGT

CTGAC - UNI17534 - GGAGGCTGTACTGCCCAAGCTGCACCTGGATGAGGACTATCCCTGCTCGCTTGTGGGCAACTGGAACACGTGGTACGGGGA

GCAGGACCAGGCAG - UNI24295 - TACACCTATGGCGGTTCTCAGGTGGCTACCCGGCCCTCATGGACTGCATGAACAAGCTAAAAAACAACAAG 

GAGTACCTGGAGTTCCGGAAGGAACGGAGCAAGATGCTGCTGTCCAGGAGAAACCAGTTGCTTCTGGAGTTCAGCTTCTGGAATGAGCCACAGCCCCGAG

CTGGCCCCAATATCTATGAGCTGAGGACATATAAACTCAAG - UNI23850 - CCAGGAACCATGATTGAATGGGGAAACAACTG GGCTCGGGCCAT

CAAGTACCGTCAGGAGAACCAGGAGGCGGTGGGAGGCTTCTTTTCACAAATAGGAGAGCTCTACGTGGTACACCACTTATGGG CCTACAAAGATTTGCA

ATCTCGGGAGGAGACTCGAAATGCGGCCTGGAGAAAGAGGGGCTGGGATGAAAATGTCTACTACACAG TCCCCTTGGTTCGACACATGGAGTCACGAAT

CATGATTCCTCTGAAGATTTCTCCTCTCCAGTGAAGCTGGCACTGCCTCCACCTCCTTCCCTTTCTCCTGTGGACTAGCCTGGAAAGGAGGCGCTTCTAG

GCCACCTGGCACAGTTTTCTCTGAACTCTGGAAGACTTCTGATGGGTGGTGTTCAGCTTCGACAAAGATGACGTTTTCTGAGAACTTAGTCCGTCCGTAC

CCAGCTAACCTCTCTCCCATGCTGGATGAAGAAGTTCTTAACTTCCCAAGCTGCAGAATAGCAACCTTTTAAGCTTTCACACACTTTCCTCTTAAGATCC

GTCATCTCCAGGACATAAGTCCCCAGCTCCCAACTGTGGCCATGGCTTAGTTGCATAAAAGCAGGCATGACTGGCTGTTAGGAGGTATGGTGTGAAAGGG

TATCAGTCCAGGTATGGCCCGGGAACTCTCTGGTGTCTACTTGTTAAAAAAGCAAGCCTGAGTCTTTAAAAAAAAATAAATAAAAATCCTGGAACTGCCA

TAAAGTCTGAAGTCGTGACAGTCAGGAGGAAATCCAGAAGTTATCAGTGTCAGTAGGTGGTCCAGAAGTCTACTTAAAGGGCTAGGAAAAGGGTGGGAGT

GGGAAGGATCTGGGTACATGAGACAGCCTTGAAGCAGGAACCCTTCACAAGTGGGCACATAGGATTCAGAATTTAAAATACAGAATTGGGAAGACAGGAC

AGAGGTGACAGAGGATCTTAAGGGAGCACCCTGTTCCTAGACAGATGGAGAGGCGTATCCATGTTTTCCTACATAATGTGGTTAAAACTTGAATTTGTGC

TTCAGCTCTTCTGTACTTCTTCCTTCCTACAGGCAAAAACACAGGCTGAGACCTATAGTTCCATCAAATTCTTTCTTTCCCTTCTTGACATTGTCCCCCA

AACCCTCATTTTGCAGAAACACTAGGTCTGTGGAGTAGGTTGTGATTCTGGGGTCTCTTCAATGACCCCGGTACCTCATGAACCCCTGCTTAGCATGGTT

GTGCTACCATCCAGGAGAATGTTGATGGAACCAAATTAAATATTTACTGT
Translation
MSYCEPSSGAKVWVAEWSRFSACYYLLLGQQPCPFRAKATPFGAPLEGLVFKCCSPICPYDPWKLLKH - UNI20908 - HFYSKDSEGSWFRSLFVH

KVDPRKDAHSTLLSKKETSNLYKIQF - UNI23715 - FHNVKPECLDAYNSLT - UNI17534 - TEAVLPKLHLDEDYPCSLVGNWNTWYGEQD

QAV - UNI24295 - VHLWRFSGGYPALMDCMNKLKNNK EYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPRAGPNIYELRTYKLK - UNI23850

 - PGTMIEWGNNW WARAIKYRQENQEAVGGFFSQIGELYVVHHLWA AYKDLQSREETRNAAWRKRGWDENVYYTV VPLVRHMESRIMIPLKISPLQ

Transcript ENSMUST00000038570
Sequence
AACATGGCTCCGCGGTTGTGCATCATCTCTGCAGCGGCACGGCGGCTATTCACGAAGCCGAGACCCCGTGCTGGGGACCTCGCGGCTGCGGGTGCTGTGC

G - UNI20908 - - UNI29663 - CTTCTATTCCAAGGACAGTGAAGGAAGCTGGTTCCGTTCCCTCTTTGTCCACAAGGTGGATCCTCGGAAGGA

CGCCCACTCCACTCTGCTGTCCAAGAAGGAGACTAGTAATCTCTACAAGATCCAGT - UNI23715 - TTCACAACGTGAAGCCCGAATGTCTGGATG

CCTACAACAGTCTGAC - UNI17534 - GGAGGCTGTACTGCCCAAGCTGCACCTGGATGAGGACTATCCCTGCTCGCTTGTGGGCAACTGGAACACG

TGGTACGGGGAGCAGGACCAGGCAG - UNI24295 - TACACCTATGGCGGTTCTCAGGTGGCTACCCGGCCCTCATGGACTGCATGAACAAGCTAAA

AAACAACAAG GAGTACCTGGAGTTCCGGAAGGAACGGAGCAAGATGCTGCTGTCCAGGAGAAACCAGTTGCTTCTGGAGTTCAGCTTCTGGAATGAGCC

ACAGCCCCGAGCTGGCCCCAATATCTATGAGCTGAGGACATATAAACTCAAG - UNI23850 - CCAGGAACCATGATTGAATGGGGAAACAACTG G

GCTCGGGCCATCAAGTACCGTCAGGAGAACCAGGAGGCGGTGGGAGGCTTCTTTTCACAAATAGGAGAGCTCTACGTGGTACACCACTTATGGG CCTAC

AAAGATTTGCAATCTCGGGAGGAGACTCGAAATGCGGCCTGGAGAAAGAGGGGCTGGGATGAAAATGTCTACTACACAG TCCCCTTGGTTCGACACATG

GAGTCACGAATCATGATTCCTCTGAAGATTTCTCCTCTCCAGTGAAGCTGGCACTGCCTCCACCTCCTTCCCTTTCTCCTGTGGACTAGCCTGGAAAGGA

GGCGCTTCTAGGCCACCTGGCACAGTTTTCTCTGAACTCTGGAAGACTTCTGATGGGTGGTGTTCAGCTTCGACAAAGATGACGTTTTCTGAGAACTTAG

TCCGTCCGTACCCAGCTAACCTCTCTCCCATGCTGGATGAAGAAGTTCTTAACTTCCCAAGCTGCAGAATAGCAACCTTTTAAGCTTTCACACACTTTCC

TCTTAAGATCCGTCATCTCCAGGACATAAGTCCCCAGCTCCCAACTGTGGCCATGGCTTAGTTGCATAAAAGCAGGCATGACTGGCTGTTAGGAGGTATG

GTGTGAAAGGGTATCAGTCCAGGTATGGCCCGGGAACTCTCTGGTGTCTACTTGTTAAAAAAGCAAGCCTGAGTCTTTAAAAAAAAATAAATAAAAATCC

TGGAACTGCCATAAAGTCTGAAGTCGTGACAGTCAGGAGGAAATCCAGAAGTTATCAGTGTCAGTAGGTGGTCCAGAAGTCTACTTAAAGGGCTAGGAAA

AGGGTGGGAGTGGGAAGGATCTGGGTACATGAGACAGCCTTGAAGCAGGAACCCTTCACAAGTGGGCACATAGGATTCAGAATTTAAAATACAGAATTGG

GAAGACAGGACAGAGGTGACAGAGGATCTTAAGGGAGCACCCTGTTCCTAGACAGATGGAGAGGCGTATCCATGTTTTCCTACATAATGTGGTTAAAACT

TGAATTTGTGCTTCAGCTCTTCTGTACTTCTTCCTTCCTACAGGCAAAAACACAGGCTGAGACCTATAGTTCCATCAAATTCTTTCTTTCCCTTCTTGAC

ATTGTCCCCCAAACCCTCATTTTGCAGAAACACTAGGTCTGTGGAGTAGGTTGTGATTCTGGGGTCTCTTCAATGACCCCGGTACCTCATGAACCCCTGC

TTAGCATGGTTGTGCTACCATCCAGGAGAATGTTGATGGAACCAAATTAAATATTTACTGT
Translation
MAPRLCIISAAARRLFTKPRPRAGDLAAAGAVR - UNI20908 - - UNI29663 - RFYSKDSEGSWFRSLFVHKVDPRKDAHSTLLSKKETSNLY

KIQF - UNI23715 - FHNVKPECLDAYNSLT - UNI17534 - TEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAV - UNI24295 - VHLWR

FSGGYPALMDCMNKLKNNK EYLEFRKERSKMLLSRRNQLLLEFSFWNEPQPRAGPNIYELRTYKLK - UNI23850 - PGTMIEWGNNW WARAIKY

RQENQEAVGGFFSQIGELYVVHHLWA AYKDLQSREETRNAAWRKRGWDENVYYTV VPLVRHMESRIMIPLKISPLQ

For any suggestions or comments, please send an email to unitrap@crg.es