Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034303 (Ccdc15)
Chromosomal location
Chr 9: 37083420 - 37155977 (-)
Description
coiled-coil domain containing 15 Gene [Source:MGI Symbol;Acc:MGI:2444488]
RefSeq_dna
NM_001081429 
RefSeq_peptide
NP_001074898.1 
UniGene
Mm.390150 
MGI
MGI:2444488 
Uniprot/SWISSPROT
Q8C9M2 
Human Ortholog
ENSG00000149548 (CCDC15)
Omim not available
UniTrap UNI4063
Vector Insertion
Chr 9: 37151619 - 37155322
Public Clones AP1021 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037275
Sequence
GGAAGAGGCAGGGCAGGCGTGGGCCCCGGGGTGGCAGTTTGCTGTTTGTCCTTTGCGTAGCAGCCCGCGGAGTTTGAGTCTGTGTGTGAGACGGACCGGA

TCGCGGCAGGCTCCAGGCTTCACAGGTCTCCTATCCAACTGTTGGAGCCTCACAGGACCCCGCTTTCCTGGCCGGGCTTCAGACGCCCCCCACCTCCTGT

GCCCAGGCTTCTTAAGACCCCCGGCTCCTGCCCGGGCCTTAGACTCCCCTCCAGCCCCATGCCGTGGGCCGGCGCTTTTCCACCCGCGGTCATCTCAGAC

TCAAGCCCTGCCCTTAGCGCCCGCCTATGCTCACCTCTGGGCAGGCTTTCATCTCCCAA AAGTCAATGCCAGGAGGTATGGCGCCCCTCAAGAAGCCTC

GGAATCCCACAAAATTGCCCCTGGCTTTAAATCCCACGAAGAGCAAGGACGTTTTGGCAGTGCTGGCTGAGAGGAACCAGGCCATAATACCAGTTGGGGC

TTGGGTGGAACCTGCCTCACCAAATTGGTCGGGAATTCCAGCACAT - UNI4063 - ACTTCAGCATACGTAGTTGAAGAGGAAATAAAGGAACAGCA

ACGAAGAAAGCAAGAGTCTCTGAGACATTTTCAGAGACAAGTCAGGCACCGGGTCAATCAGCGGGTTAAGCTGAGGAAAAAGCAACAACTTCACAAGTCT

TACAAAGCA GCAGAAAAGGAAGGCTCTATAGCCATGCAGTATTCAGATTTGGCACATTTATCTTCTAAAAGGACAAGTGTTTTCCCTAGCAATTTGAAT

GCTGCTGTTGGAAGGTTTAGGTTACCCACTTCCCAGGTGCTTGGTGATGCAATAGAAGATGGAGAGAATCAGTTGTTTCAACAACAAGCTCAAGCT CTT

AGTCAAACTATGAAACAGGCACGTCACCAGCTGGCATCCTTTAAAACTGTGAGTGAAAAAAAGACACCAGTGCTTCCAAATGGTGGAAGGAAAGGTTGTC

CCACCCAAGAG GGCCTTGGCTGTGGGAAAATTTCATTTGTTGCTGTAAGTGAGGAGAGAGATGCTTTGTTTGTGAGCTGCCAGCAGGATTTCCTTTCTG

AAGACAAAGAAAAGGCTTTCAGCAAAGTTCAG AAAGTAAAATTCAAAAATCCCTTATCTGTTGTGATAAAAGAAGATGAACGAAAGCAATTACATCCTC

ATAGCCTTCAGGCTGTTCTTCCAGAAGCCCAGGATTATTTTGTAGAAGTTCAAAGCGGCCTTCCAGAATCTCAGAGTGATGTGATAGACGTCCAGAATGT

TGAGCCTAAAGCTTCAAGAATTGAACCTAAAACTCTAGGTGTTGAGCCAGACACCCAGGCCACTGGTGTGGAGTGTCAGACTACAGAGCCAGAAGGCCAG

GCTGTTAAGACGGGGATTCAGGATGTTCCTAAAGTCCAGACTGTTGAGCTAGATGGCAATACTGAGCTGGAAGCCCAGGATTTTCTACCCTCGCACCAGG

CCTTTCTATCCAGAGACACAGATTGTCTACCCAATTGTCAATACCAGGATTCTTTACCCAAAGGTCACTGTGTTCTCCCTAATTACTGGAATGTTTTACC

TAAATACCAGAACCAGCATTTTCTACCAGTAGACCAGGAGTTTCTACCTAGAAACCAACTTGCTTTACCCAAAGAACAGAATCACCCACTTCAATGTCAG

AAGCAGGATCTCCTACCTAGAGAACAGTTTCCCCTGCTGCTGAGACACCAGGACCAAAGAGAGCCACATGTTCTTCCTAAATGTCAGGAGCATGATGTTC

TTTCCAAAGCCCAGAATTATCTACACAATTATCAGGAGCAGGATCTTCAACTCCAAAACCAG GAAGTAAACTCTAAGGAGCCACTCTCTGATATAACAG

ATGGGAAAGGGAGAGAAATATTTTCTCTG GACATGTTTTCCAAGAAACCCTCAACTTTTATGAGAAGAGAGAGGGGGGATGAGGAGTTACCTCTGGACT

CTCCTCAGTGTGCTCCACCTCAGATCCAGGACCAAGTCTTCCTTAGAGAACAG AGCCAGCAGCCCTCTGTTAGGACAGCTGAACGGTGGCAAGAGGATT

TGTATCTCAGTGGCCATGAATGTCTTCCACCCAGACAACGGAGAGACACGTGCAGCAGGCAACAG CAGGTCTATGAGGAGTATCGGTCGGGACTGAGCA

CTGAACAGCAGGCTCTGCTGGCATTTCAGTCTGGAGTGGATCAAGAAGAAGATAAAAAAGAG CGTCAAAAGCAATATCTGAGACACAGGAGGCTTTTCA

TGGATATTGAGAGAGAACAAGTGAAAGAACAGAACAGACAAAGGGAACGAAAGAGGAGGATTGAAAA AATTAAGAAAAAGAAAGAACAACAACGCTATG

CTGAAGAGCAGAGACTCCTAAGAATGAACTGTCATGAAGAACCTTATTCAGAAGAGAAGATAAGTGATGTGTTAGCCCAGTTACAACTGGAAGAAATAAA

AGGAGCCAGAGAAAAACAGCAACAGAGAGAAAAAGAGTACATAAG ATATGTAGAAGCTTTACGAGCCCAGGTCCAGGAGAAGATGAAGCTTTATAATAT

CACTTTACCTCCATTATGCTGTTGTGGTCCTGATTTTTGGGATGCTCATCCTGATACCTGTGCCAACAATTGCATTTTCTATAAAAACTACAGGG CATA

TAATCGGGCATTGCATTCAGTCATCAATTCTTCTGATATCTCTGAGGGGAACGCAACTCTTCGAAATGCCATTCGTAATTTTGCTTCTGCACATAGACGG

ACTCCAAAACAAAGTCTCCA CTAAAGAGTGTCAGCAAAATGCTGTCATGTAGAAAACCACAAGACAACCTGAAGCTACTGGAAGCCACCACAGTGTCAA

CAGTTCCAGCCTCACAGTGCACCCCTGAGCTATAGCCCTTCCAAAAGGCATTTTCCCCACGCCAAGCAAGGAACATCAAGAGTTTGTTTCTGAAATTGTG

TTTACTTTACAAACTATAGATATGTTTTATGTCCAGTTTTCAATTTGGGCCTTAGAGCTAATATTGATGTTAATATCACCTCACAAGCTGAAAGCATAAT

GCTAGAAGCGTAATGCTAGAAATGTCTTCAAATTCCTTGTCATACCAAAAGCAAAATGCAAAGAAAGGAGAACACAAGAGCACCTTTTAATTTTAAAGTG

TTTGGAAACATGTACAGCTTGGATACAATTTCAGAGCTCCAGACACACATGTCCTTGTCATGTAAGCCAGACGCTTTGAGAAGCTGCAGTGGGACTGTGG

TTAGATTCTAACTTAAACCCAATGAGGGCAATAGACACAGCTCAAATAAGACTTGCGGATCATAGTATTCCCCTCTTTATGGTATGTGCAAGGGGACATA

TAAACATTTCTAGTTGTGCATGATGGTACATGTCTTTAATCCCATTACTATGGAGGCTGATGCAGAAGGATCAGGAGTTTGAGGACAGCTGAGCTACATG

AAACTGTCTCAAAAAAAATTTTAAGCCAAATAAAATAGTTGTTTTTCCTTCT
Translation
MLTSGQAFISQ KSMPGGMAPLKKPRNPTKLPLALNPTKSKDVLAVLAERNQAIIPVGAWVEPASPNWSGIPAH - UNI4063 - TSAYVVEEEIKEQ

QRRKQESLRHFQRQVRHRVNQRVKLRKKQQLHKSYKA AEKEGSIAMQYSDLAHLSSKRTSVFPSNLNAAVGRFRLPTSQVLGDAIEDGENQLFQQQAQA

 LSQTMKQARHQLASFKTVSEKKTPVLPNGGRKGCPTQE GLGCGKISFVAVSEERDALFVSCQQDFLSEDKEKAFSKVQ KVKFKNPLSVVIKEDERKQ

LHPHSLQAVLPEAQDYFVEVQSGLPESQSDVIDVQNVEPKASRIEPKTLGVEPDTQATGVECQTTEPEGQAVKTGIQDVPKVQTVELDGNTELEAQDFLP

SHQAFLSRDTDCLPNCQYQDSLPKGHCVLPNYWNVLPKYQNQHFLPVDQEFLPRNQLALPKEQNHPLQCQKQDLLPREQFPLLLRHQDQREPHVLPKCQE

HDVLSKAQNYLHNYQEQDLQLQNQ EVNSKEPLSDITDGKGREIFSL DMFSKKPSTFMRRERGDEELPLDSPQCAPPQIQDQVFLREQ SQQPSVRTAE

RWQEDLYLSGHECLPPRQRRDTCSRQQ QVYEEYRSGLSTEQQALLAFQSGVDQEEDKKE RQKQYLRHRRLFMDIEREQVKEQNRQRERKRRIEK KIK

KKKEQQRYAEEQRLLRMNCHEEPYSEEKISDVLAQLQLEEIKGAREKQQQREKEYIR RYVEALRAQVQEKMKLYNITLPPLCCCGPDFWDAHPDTCANN

CIFYKNYRA AYNRALHSVINSSDISEGNATLRNAIRNFASAHRRTPKQSLH H

For any suggestions or comments, please send an email to unitrap@crg.es