Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034311 (Kif4)
Chromosomal location
Chr X: 97821076 - 97922278 (+)
Description
kinesin family member 4 Gene [Source:MGI (curated);Acc:Kif4-001]
RefSeq_dna
NM_008446 
RefSeq_peptide
NP_032472.2 
UniGene
Mm.383091 
MGI
MGI:108389 
Uniprot/SWISSPROT
P33174 
Uniprot/SPTREMBL
Q3UWH4 Q3UXW0 Q80YP3 
Human Ortholog
ENSG00000090889 (KIF4A)
Omim not available
UniTrap UNI14614
Vector Insertion
Chr X: 97821928 - 97822042
Public Clones FHCRC-GT-S5-2H1 (fhcrc)
Private Clones OST32517 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25894
Vector Insertion
Chr X: 97822158 - 97829177
Public Clones not available
Private Clones OST153978 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35820
Vector Insertion
Chr X: 97834111 - 97860074
Public Clones IST13949E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4474
Vector Insertion
Chr X: 97875454 - 97884396
Public Clones AA0042 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 39% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048962
Sequence
GGGATTGGGGCCAGACACAATCTCTAGAGGTGCTTAGTAAACGTGGTGTCCACAGACGGGTTCCGTCTACACGGGCTACCTTCTAGATCCAGGTCCTGCA

ACCCGCCCGAATCCCGCGCTCGCGACCACTTAACTCAGGGCCACCTCACCGGTAAGAAGGCCTCGGTCAGCGACAGCCAATTCGGCGTCGGAACCGGAAG

CGGATGCTCCTACCACCCTGCCGGGGCGGAGCTCTCTTTGGGCGAGCCAGAGCTCCAGCCTCCTTGCGCGTCACGGTGTGCGTGCTCAAGTTCGTCTGCT

TCTCACAGGCTGTACGCGCTCCGATTGGCTGGCGCCTCTGGGATCAATTTGAAACTTGGCGGTTAAAGCTCCGGTTGGAACAGGGCGCCAGGGAAGGTCG

GTGAGAGGGACGTTTAGTTTGGTGAGTTACCCGGGCACCGCGTTAGCTCCGATTCTGCGCTTTGGAGCACTTTAGGGCTTGGGGTCGCGGTTGCTGTCTC

TGCTGGAGTTTCCTTATTGCTGACGCCGCTTCGCCCTGCAGTATTGGGACTGACAAACCTTTAGGCGGTGGCCAAGAGTGACAGGACACCGTGATCCCGC

TGGGAGGGAGAGTGCATCAGCGAGTTCCGAGCTCTCCCACCGCCTGAGAAGGGCCTTTCCACTCCTGCCAGCCTCCGGGGGCTCCTGGGAGAGCCGGCTT

CACCCAGCACGGACACCTGCTGAGCTGGTACCATGAAAGAAGAGGTGAAGGGGATTCCCGTAAGAGTGGCACTGCGTTGTCGCCCCCTCGTCTCGAAAGA

GATTAAGGAGGGCTGCCAGACGTGCCTTTCCTTTGTGCCCGGAGAGCCTCAG - UNI14614 - GTGGTGGTTGGTAATGATAAATCATTTACCTACG

ATTTTGTGTTTGACCCCTCTACTGAACAGGAAGAGGTCTTTAATACAGCAGTAGCTCCACTCATAAAAGGCGTGTTTAAAG - UNI25894 - GATAC

AATGCAACTGTCCTGGCCTATGGGCAGACTGGATCTGGAAAAACGTATTCAATGGGAGGTGCATACACTGCAGAACAAGAACATGACTCAGCCATTGGGG

TTATTCCCAGGGTAATACAACTGCTCTTCAAAGAAATTAATAAAAAGAGTGACTTCGAATTTACTCTGAAAGTGTCTTACTTGGAG ATCTATAATGAAG

AAATTTTGGACCTTCTATGTTCATCTCGTGAGAAAGCTACTCAAATAAATATCCGGGAGGACCCTAAGGAAGGCATAAAG ATTGTGGGACTGACAGAGA

AGACTGTGCTGGTGGCCTCGGACACCGTTTCCTGTCTAGAGCAGGGTAACAACTCCAGGACTGTGGCCTCCACAGCTATGAACTCCCAGTCATCTCGATC

TCATGCCATCTTTACAATCTCCATTGAGCAAAGGAAGAAGAATGACAA AAATAGCAGCTTTCGTTCCAAGCTGCATCTTGTAGACCTCGCTGGATCAGA

AAGACAGAAGAAAACCAAGGCTGAGGGAGATCGACTGAGAGAGG - UNI35820 - GTATTAATATTAATCGAGGCCTTCTGTGCTTGGGGAATGTAA

TCAGTGCTCTTGGAGATGATAAAAAGGGTAACTTTGTGCCCTACAGAGATTCCAAGCTGACTCGACTGCTTCAAG ATTCTCTAGGAGGCAATAGCCACA

CTCTTATGATTGCCTGTGTGAGTCCTGCTGATTCCAATCTAGAAGAAACATTAAATACCCTTCGCTATGCTGACAGAGCAAGAAAAATCAAGAACAAACC

TATTATTAATATTGATCCCCAGGCAGCTGAACTAAATCATCTTAAACAACAG GTCCAACAGCTGCAGATCTTGCTGCTACAAGCCCATGGAGGCACCTT

GCCTGGAGATATAAA TGTGGAACCATCAGAAAATCTTCAGTCCCTGATGGAGAAGAATCAGTCTCTGGTGGAAGAGAATGAAAAATTAAGTCGTGGTCT

GAGTGAGGCAGCTGGTCAAACAGCCCAGATGCTGGAGAGGATCATTCTG ACAGAGCAAGCAAATGAGAAAATGAATGCCAAGCTAGAAGAACTCAGGCG

GCATGCGGC CTGTAAAGTGGATCTTCAAAAGCTCGTGGAGACATTGGAAGACCAGGAGTTAAAAGAAAACATAGAGATAATTTGCAACCTACAACAAGT

GATTGCCCAGCTATCT - UNI4474 - GATGAAGCTGCTGCTTGCATGACTGCAACCATTGATACTGCAGGGGAAGCAGACACT CAAGTGCAAAGCA

GCCCAGATACCAGCAGGTCTTCTGATGTTTTCAGCACTCAGCATGCCCTACGCCAAGCTCAGATGTCCAAGGAGCTGATTGAGTTGAATAAAGCACTTGC

ACTGAAGGAAGCCCTAGCTAAGAAGATGACTCAGAATGACAACCAACTCCAGCCCATTCAGTTCCAGTACCAG GATAATATTAAAAATCTAGAATCAGA

AGTCCTCAGTCTACAGAGGGAAAAAGAAGAACTGGTTCTTGAACTTCAAACAGCAAAGAAGGATGCCAACCAAGCCAA GTTGAGTGAGCGCCGTCGTAA

ACGTCTTCAGGAACTGGAGGGTCAAATAGCTGATTTGAAAAAGAAACTGCAAGAACAGTCCAAACTTCTGAAGCTGAAGGAATCCACAGAGCATACTGTC

TCCAAGCTGAACCAGGAGATTCGG ATGATGAAAAACCAGCGAGTCCAGTTAATGCGTCAAATGAAAGAGGATGCTGAGAAGTTTAGGCAATGGAAGCAG

CAAAAAGACAAAGAAGTAATCCAGCTAAAAGAACGG GATCGTAAAAGGCAATATGAGCTGCTCAAACTTGAAAGAAACTTTCAGAAGCAGTCTAATGTG

CTCAGACGTAAAACTGAGGAG GCAGCAGCTGCCAACAAACGTCTTAAGGATGCTCTGCAAAAGCAAAAGGAGGTTGCAGAAAAACGCAAAGAGACTCAG

AGCCGTGGGATGGAAAGCACTGCAGCTAGAATGAAG AATTGGCTTGGAAATGAAATTGAGGTTATGGTCAGTACTGAGGAAGCCAAGCGACATCTGAAT

GGCCTTCTTGAAGAGAGAAAGATCCTGGCTCAGGATGTGGCACAACTCAAAGAGAAAAGAGAATCTGGAGAGAACCCACCTCTTAAACTCCGA AGGCGC

ACATTTTCCTACGATGAAATACATGGTCAAGATTCAGGAGCAGAGGATTCTATTGCCAAGCAGATTGAAAGCCTAGAGACCGAATTGGAGCTCAG GAGT

GCGCAGATTGCGGACCTACAGCAAAAGCTGCTGGATGCTGAAAGTGAAGACCGGCCGAAACAGCGCTGGGAGAGTATCGCCACAATTCTCGAAGCCAAAT

GTGCCATAAAGTATTTAGTGGGAGAG CTCGTCTCCTCCAAAATACTGGTGAGCAAACTAGAAAGCAGCCTGAATCAGAGCAAGGCCAGCTGTATTGACG

TGCAGAAGATGCTGTTTGAGGAGCAAAATCATTTTGCTAAGATAGAGACAGAGTTAAAAGAAGAGCTGGTCAAAGTGGAGCAACAGCACCAAGAAAAG G

TGTTGTACCTTCTCAGCCAGCTGCAGCAATCCCAGATGACAGAGAAGCAGCTGGAGGAGTCAGTTAGTGAAAAGGAACAGCAGCTGCTGAGCACACTAAA

ATGTCAG GAGGAAGAGCTTAGGAAGATGCAAGAAGTGTGTGAGCAAAATCAGCAGCTTCTCCAAGAAAACAGTGCCATCAAGCAG AAACTGACCCTAC

TCCAAGTAGCCAGCAAACAGAAACCCCATCTCACAAGAAATATCTTCCAGTCTCCAGACTCTTCCTTTGAATATATTCCACCTAAG CCCAAACCTTGCC

GCATTAAGGAAAAATGCCTAGAGCAAAGCTTCGCCGTCGAGGGGCTGCAGTATTATTCAGAGCCTTCTGTGGCCGAGCAGGACAATGAGGACAGTGACGA

CCATGCTGATGAGGAGTGGATCCCAACAAAACTAGTCAAGGTGTCCAAGAAGAGCATCCAAGGG TGTTCCTGCAAAGGTTGGTGCGGGAACAAGCAATG

TGGATGCAGAAAGCAAAAGTCAGACTGTAATGTGTCCTGCAGCTGTGACCCCACAAAGTGTCGCAACCGCCATCAGAACCAG GACAATTCAGATGCTAT

TGAGCTAAACCAAGATTCTGAAAACTCTTTCAAACTGGAAGATCCCACAGAGGTGACCTCAGGCTTAAGCTTCTTCCACCCTATCTGTGCAACTCCCAGT

AGCAAG ATCCTAAAAGAAATGTGTGATGCAGATCAGGTGCAGCTGAAGCAGCCCGTGTTTGTCTCTTCTTCTGACCACCCAGAACTGAAGTCTATAGCG

TCAGAATCACAAGAAAATAAGGCCATAGGGAAGAAGAAGAAGCGAGCTCTGGCCAGCAATACCAGCTTCTTCTCTGGCTGCTCTCCTATCCAAGAAGAGT

CCCACTGAGTTTAGGGCCATTGTCTCTTCTGTCTGCCGTGGACACAGTCCGAGGGTGAGGCACAGAGGGGAAGAGCACTAATGACTTCAGTAGTTTTAGG

TCTTGCTATTGAGAAAATGAGAAAAGTGTCCCTGAAAGGAGGAGGACCTTGGCTGAGTGTTGGCCTTTACTATCTAAGCCTTCAAACAACTACTTTGCTT

CTCTAGAAGGCATTGAGCCTTCTACTGGAGAGAGAACCAACTGACCTGCCTGATAAGTCTAGAGGAGCCAGTCCCCAGTACAGTCTAG
Translation
MKEEVKGIPVRVALRCRPLVSKEIKEGCQTCLSFVPGEPQ - UNI14614 - VVVGNDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKG - UNI2

5894 - GYNATVLAYGQTGSGKTYSMGGAYTAEQEHDSAIGVIPRVIQLLFKEINKKSDFEFTLKVSYLE IYNEEILDLLCSSREKATQINIREDPKE

GIK IVGLTEKTVLVASDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKNDK KNSSFRSKLHLVDLAGSERQKKTKAEGDRLREG - UNI

35820 - GININRGLLCLGNVISALGDDKKGNFVPYRDSKLTRLLQD DSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIINIDPQAA

ELNHLKQQ VQQLQILLLQAHGGTLPGDIN NVEPSENLQSLMEKNQSLVEENEKLSRGLSEAAGQTAQMLERIIL TEQANEKMNAKLEELRRHAA AC

KVDLQKLVETLEDQELKENIEIICNLQQVIAQLS - UNI4474 - DEAAACMTATIDTAGEADT QVQSSPDTSRSSDVFSTQHALRQAQMSKELIEL

NKALALKEALAKKMTQNDNQLQPIQFQYQ DNIKNLESEVLSLQREKEELVLELQTAKKDANQAK KLSERRRKRLQELEGQIADLKKKLQEQSKLLKLK

ESTEHTVSKLNQEIR MMKNQRVQLMRQMKEDAEKFRQWKQQKDKEVIQLKER DRKRQYELLKLERNFQKQSNVLRRKTEE AAAANKRLKDALQKQKE

VAEKRKETQSRGMESTAARMK NWLGNEIEVMVSTEEAKRHLNGLLEERKILAQDVAQLKEKRESGENPPLKLR RRTFSYDEIHGQDSGAEDSIAKQIE

SLETELELR RSAQIADLQQKLLDAESEDRPKQRWESIATILEAKCAIKYLVGE LVSSKILVSKLESSLNQSKASCIDVQKMLFEEQNHFAKIETELKE

ELVKVEQQHQEK VLYLLSQLQQSQMTEKQLEESVSEKEQQLLSTLKCQ EEELRKMQEVCEQNQQLLQENSAIKQ KLTLLQVASKQKPHLTRNIFQSP

DSSFEYIPPK PKPCRIKEKCLEQSFAVEGLQYYSEPSVAEQDNEDSDDHADEEWIPTKLVKVSKKSIQG CSCKGWCGNKQCGCRKQKSDCNVSCSCDP

TKCRNRHQNQ DNSDAIELNQDSENSFKLEDPTEVTSGLSFFHPICATPSSK ILKEMCDADQVQLKQPVFVSSSDHPELKSIASESQENKAIGKKKKRA

LASNTSFFSGCSPIQEESH

For any suggestions or comments, please send an email to unitrap@crg.es