Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034317 (Trim59)
Chromosomal location
Chr 3: 68839210 - 68848677 (-)
Description
tripartite motif-containing 59 Gene [Source:MGI (curated);Acc:Trim59-001]
RefSeq_dna
NM_025863 
RefSeq_peptide
NP_080139.3 
UniGene
Mm.176695 Mm.475663 
MGI
MGI:1914199 
Uniprot/SWISSPROT
Q922Y2 
Human Ortholog
ENSG00000213186 (TRIM59)
Omim not available
UniTrap UNI12299
Vector Insertion
Chr 3: 68847766 - 68848534
Public Clones (sanger) 5SD027C10 (ggtc) P103G04 (ggtc) 3SD181F05 (ggtc) 3SD018C10 (ggtc)
5SP101E01 (ggtc) M003D01 (ggtc) 5SD181F05 (ggtc) 3SP101E01 (ggtc)
IST15043G5 (tigm) IST12161E6 (tigm) IST14571F6 (tigm) IST13609H8 (tigm)
Private Clones OST310026 (lexicon) OST260167 (lexicon) OST86450 (lexicon) OST59726 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10116
Vector Insertion
Chr 3: 68847689 - 68847765
Public Clones XST047 (baygenomics) XST027 (baygenomics) XST032 (baygenomics) XST050 (baygenomics)
XST028 (baygenomics) XST034 (baygenomics) XST009 (baygenomics) XST030 (baygenomics)
P095B01 (ggtc) W265C08 (ggtc) P149B02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4787
Vector Insertion
Chr 3: 68841931 - 68847689
Public Clones AW0141 (sanger) SYA173 (baygenomics) P010D06 (ggtc) FHCRC-GT-S20-5G1 (fhcrc)
PST14529-NR (escells)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14999
Vector Insertion
Chr 3: 68839214 - 68847765
Public Clones (sanger) P103G04 (ggtc) P095B01 (ggtc) P151G10 (ggtc) PST6282-NL (escells)
PST14038-NR (escells) PST8078-NR (escells) PST10533-NR (escells) PST6740-NR (escells)
PST23831-NR (escells) PST14772-NR (escells) PST10277-NR (escells) PSTVU02.PA17-2 (vanderbilt)
IST14977E2 (tigm) IST14655F1 (tigm)
Private Clones OST316001 (lexicon) OST308358 (lexicon) OST288557 (lexicon) OST252175 (lexicon)
OST197826 (lexicon) OST105137 (lexicon) OST59245 (lexicon) OST41680 (lexicon)
OST33539 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107802
Sequence
GCCCCCGCCGGGCACCTGAAGACTCGGGCGAGCGCCTCGCAGTGTCCGCACCAGGCTGCCCGGGAGCCCTCGCCGTGCGCGCCGTCGCCCGCCTCGCCCG

CCTCGCCCGCCTCGCCCGCCTCGCCCGCCTCGCCCGCCTCGCG - UNI10116 - - UNI12299 - - UNI14999 - AATAACAAAGGATCCTG

GAAAAGTTGGAGAAGATAAAGTACACCCAGTGTCCAGATCAGGAGATTGACAGACCAG - UNI4787 - - UNI10116 - - UNI14999 - GAA

ATGCACAATTTTGAGGAGGAGTTAACGTGTCCCATCTGTTACAGCATCTTTGAAGATCCCCGTGTACTACCATGCTCTCATACATTTTGTAGAAACTGTT

TGGAAAATGTTCTTCAGGCATCTGGTAACTTTTACATATGGAGGCCTCTGCGAATTCCACTCAAGTGTCCTAACTGCAGAAGTATTATTGAAATTGCTTC

TACTGGCATAGAATCCTTACCTGTAAACTTTGCATTACGAGCAATTATTGAAAAGTACCAGCAAGAAGACCACCCAGATGTTGTCACCTGCCCTGAACAC

TACAGGCAACCATTAAATGTTTATTGTCTACTAGATAAGAAATTAGTTTGTGGCCATTGTCTTACTATAGGCCAACATCATGGCCATCCTATAGATGACC

TTCAAAGTGCCTATCTGAAAGAAAAGGATACACCTCAGAAGTTGTTGAAACAGTTAACTGACACACATTGGACAGATATCACTCGCCTTATTGAAAAGCT

TGAAGAACAGAAATGTCATTCTGAGAAAATAGTTCAAGGTGATAAGGAAGTTGTTCTCCAGTATTTTAAGGAGCTAATTGATACATTAGAACAGAAAAAA

AAGTATTTTTTGGCAGCTCTTTGTGATGTTGGCAAAATGATTAATCAAGAATACACTCCACAGATTCAAGGAATGAAGGAGATAAGGGAACAACAACTTG

AATTAATGACAATAACGACATCTTTACAAGATGAGTCTCCACTTAAATTTCTGGAAAAAATTGATGAAGTCCGCCAACGTGTGCAGATGTTGAAACAGAG

ACCACTTCCTGAGGTCCAGCCTGTTGAAATTTATCCTCGAGTAAGCAATGTATTAAAAGAAGAGTGGAGCAGAATAGAAATTGGACGTATTAAGAAAGCT

GTTATTCCTGAAATGAGAGTTTCTTCAAAAAGAACGCCATGTTCCTGGTCTGATAATGATGAAAAAGAAATGGAACTTTTTAAAATTTTAAACATTGCTA

TAGTTTCACTCATTTCAGTGATACTAATGTTGATACTCCTTTTCAACCATCACATAATAACATTCTTAAATGAAATCACTTCAATATGTTTCTCTGAAGT

CTTTCTCTCTGTTTACCAGAGTTTATCTAAGAACTTATATGACTTAAACAATACAGTGTGTTACACTTTATATTTGTTAAAGGAATTTATGTGGAAAATA

GTTTCTCGTTGAAAACCTAGAATTTCCAGTTTTATGTGGGCTTCTGTATAGCAGAGGCTAAGCATTGATTGCTAGATGGAAAGTCAGGGTGGCATAAACA

GCACATCAACTTCACATCTTACAACAGATGCAGAGAAATACGATAAACTTCCCATGCTTGGCTACAAGTGCTGTCAGAAATGAGACATTACCTGAAAGAA

GACTAAAATCAAATTAGAAAATGACAACTTTTGGGTTGAATATTAATACCTTACCCTGTTTTTATTGGCTTGCTAGTTAATGTTTTATTCTGATTAATAA

GTCTTTTTCTTTAACTGTTACATGTTATAGTGGCTAACTTGGCAGTTCTTTGTATATGTAGATATAAGATTTTTAAACAAATGACAAGATCCTTGAGGTC

CACAAGCCTATTTTGATGATTTGAAGCTTTCCAATGCACAGATGGAGAGGATTTATAAGTTGTTTTAAAAATCTAGGCCAGGATTGTTTAAACCTTTTTT

TGGGGTCAAGGCTATTCATAGGTTTAGGAGCAGTCATCCCAAGTAGCACTGCTTGCTGCTTGTGGATAAACTGTCTAGTACACTTGAGTTTAATTCATCC

TTGATATCAGTGAGGTCTCAAAAACCCATCAGAAAGTGTCTGGACTGCTGGCTCTAGCACCACAAAGCAAATCAAGTACATATTTTGATTTTGTATTTTA

GCCTTGTTTTTATATGAAAACTATACGAAACGTACATTGGGACAATTATGTTTATGTGATTCATCTAATAGATTATGATGTAAAAACTATATTCATCTTA

AAATGTTTTCACCCTGTAGCTTGAGTACTGGGATTATAAGTATGAGTTGATGCTGTACCTGTTTAGTTTTAAAAGAGGTCATTAAGTCAGAACCTTTAAT

TTTGCTCACTTGACATGGACTACCATGATGCATGTGGTAGAACTTTTGGTTCACAGCCATTGAAATCCCCTACACAATGTTTTCCAGAAACCCCTTATGA

ATGCTCTTGAATGGAGACTTTATTTCAAATAAAAGCTGTGTTTCTTAAGGTCAGAACAATGCTGACAAGTTTTATCACTAAAGTCCACTTATCAGACGCA

AAATCTAGGCATGGTAACAAAATGAGGTCATTTTGAAGATGCAATGAAGGTGAGGGGAAATTATGTAAATATTAGCAAGCGAAGAATATTGGAACATTTT

TCAAGGGGTTACTAGCTTCTTTGTAGAGATGAGGAAACAAAAGTGCCAGTGTTAGCAGGTGGGAAAGCTCATTCTATTCTGCTTATAAACAACTTGAGTA

GGCTGATCTATGTAATTAACGGAAACTTCTATTTCAGTATGCCCAGTATTACATTGTAGGCTTGACGATTTTGTGTACACAATTATCTTTGTGTTCTGAT

ATACTGTTTTATATCTTTGCCAGGAGGCTGAGTTTGTACAACTTAAAAGTTTAGAAATTCTGGGTTTTATGTATAACAATATATTTTAATAAATGATATT

TTATTGAAGTCTTAGAAA
Translation
 - UNI10116 - - UNI12299 - - UNI14999 -  - UNI4787 - - UNI10116 - - UNI14999 - MHNFEEELTCPICYSIFEDPR

VLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRSIIEIASTGIESLPVNFALRAIIEKYQQEDHPDVVTCPEHYRQPLNVYCLLDKKLVCGHCL

TIGQHHGHPIDDLQSAYLKEKDTPQKLLKQLTDTHWTDITRLIEKLEEQKCHSEKIVQGDKEVVLQYFKELIDTLEQKKKYFLAALCDVGKMINQEYTPQ

IQGMKEIREQQLELMTITTSLQDESPLKFLEKIDEVRQRVQMLKQRPLPEVQPVEIYPRVSNVLKEEWSRIEIGRIKKAVIPEMRVSSKRTPCSWSDNDE

KEMELFKILNIAIVSLISVILMLILLFNHHIITFLNEITSICFSEVFLSVYQSLSKNLYDLNNTVCYTLYLLKEFMWKIVSR
Transcript ENSMUST00000042499
Sequence
GAATAACAAAGGATCCTGGAAAAGTTGGAGAAGATAAAGTACACCCAGTGTCCAGATCAGGAGATTGACAGACCAG - UNI4787 - - UNI10116 

- - UNI14999 - GAAATGCACAATTTTGAGGAGGAGTTAACGTGTCCCATCTGTTACAGCATCTTTGAAGATCCCCGTGTACTACCATGCTCTCATA

CATTTTGTAGAAACTGTTTGGAAAATGTTCTTCAGGCATCTGGTAACTTTTACATATGGAGGCCTCTGCGAATTCCACTCAAGTGTCCTAACTGCAGAAG

TATTATTGAAATTGCTTCTACTGGCATAGAATCCTTACCTGTAAACTTTGCATTACGAGCAATTATTGAAAAGTACCAGCAAGAAGACCACCCAGATGTT

GTCACCTGCCCTGAACACTACAGGCAACCATTAAATGTTTATTGTCTACTAGATAAGAAATTAGTTTGTGGCCATTGTCTTACTATAGGCCAACATCATG

GCCATCCTATAGATGACCTTCAAAGTGCCTATCTGAAAGAAAAGGATACACCTCAGAAGTTGTTGAAACAGTTAACTGACACACATTGGACAGATATCAC

TCGCCTTATTGAAAAGCTTGAAGAACAGAAATGTCATTCTGAGAAAATAGTTCAAGGTGATAAGGAAGTTGTTCTCCAGTATTTTAAGGAGCTAATTGAT

ACATTAGAACAGAAAAAAAAGTATTTTTTGGCAGCTCTTTGTGATGTTGGCAAAATGATTAATCAAGAATACACTCCACAGATTCAAGGAATGAAGGAGA

TAAGGGAACAACAACTTGAATTAATGACAATAACGACATCTTTACAAGATGAGTCTCCACTTAAATTTCTGGAAAAAATTGATGAAGTCCGCCAACGTGT

GCAGATGTTGAAACAGAGACCACTTCCTGAGGTCCAGCCTGTTGAAATTTATCCTCGAGTAAGCAATGTATTAAAAGAAGAGTGGAGCAGAATAGAAATT

GGACGTATTAAGAAAGCTGTTATTCCTGAAATGAGAGTTTCTTCAAAAAGAACGCCATGTTCCTGGTCTGATAATGATGAAAAAGAAATGGAACTTTTTA

AAATTTTAAACATTGCTATAGTTTCACTCATTTCAGTGATACTAATGTTGATACTCCTTTTCAACCATCACATAATAACATTCTTAAATGAAATCACTTC

AATATGTTTCTCTGAAGTCTTTCTCTCTGTTTACCAGAGTTTATCTAAGAACTTATATGACTTAAACAATACAGTGTGTTACACTTTATATTTGTTAAAG

GAATTTATGTGGAAAATAGTTTCTCGTTGAAAACCTAGAATTTCCAGTTTTATGTGGGCTTCTGTATAGCAGAGGCTAAGCATTGATTGCTAGATGGAAA

GTCAGGGTGGCATAAACAGCACATCAACTTCACATCTTACAACAGATGCAGAGAAATACGATAAACTTCCCATGCTTGGCTACAAGTGCTGTCAGAAATG

AGACATTACCTGAAAGAAGACTAAAATCAAATTAGAAAATGACAACTTTTGGGTTGAATATTAATACCTTACCCTGTTTTTATTGGCTTGCTAGTTAATG

TTTTATTCTGATTAATAAGTCTTTTTCTTTAACTGTTACATGTTATAGTGGCTAACTTGGCAGTTCTTTGTATATGTAGATATAAGATTTTTAAACAAAT

GACAAGATCCTTGAGGTCCACAAGCCTATTTTGATGATTTGAAGCTTTCCAATGCACAGATGGAGAGGATTTATAAGTTGTTTTAAAAATCTAGGCCAGG

ATTGTTTAAACCTTTTTTTGGGGTCAAGGCTATTCATAGGTTTAGGAGCAGTCATCCCAAGTAGCACTGCTTGCTGCTTGTGGATAAACTGTCTAGTACA

CTTGAGTTTAATTCATCCTTGATATCAGTGAGGTCTCAAAAACCCATCAGAAAGTGTCTGGACTGCTGGCTCTAGCACCACAAAGCAAATCAAGTACATA

TTTTGATTTTGTATTTTAGCCTTGTTTTTATATGAAAACTATACGAAACGTACATTGGGACAATTATGTTTATGTGATTCATCTAATAGATTATGATGTA

AAAACTATATTCATCTTAAAATGTTTTCACCCTGTAGCTTGAGTACTGGGATTATAAGTATGAGTTGATGCTGTACCTGTTTAGTTTTAAAAGAGGTCAT

TAAGTCAGAACCTTTAATTTTGCTCACTTGACATGGACTACCATGATGCATGTGGTAGAACTTTTGGTTCACAGCCATTGAAATCCCCTACACAATGTTT

TCCAGAAACCCCTTATGAATGCTCTTGAATGGAGACTTTATTTCAAATAAAAGCTGTGTTTCTTAAGGTCAGAACAATGCTGACAAGTTTTATCACTAAA

GTCCACTTATCAGACGCAAAATCTAGGCATGGTAACAAAATGAGGTCATTTTGAAGATGCAATGAAGGTGAGGGGAAATTATGTAAATATTAGCAAGCGA

AGAATATTGGAACATTTTTCAAGGGGTTACTAGCTTCTTTGTAGAGATGAGGAAACAAAAGTGCCAGTGTTAGCAGGTGGGAAAGCTCATTCTATTCTGC

TTATAAACAACTTGAGTAGGCTGATCTATGTAATTAACGGAAACTTCTATTTCAGTATGCCCAGTATTACATTGTAGGCTTGACGATTTTGTGTACACAA

TTATCTTTGTGTTCTGATATACTGTTTTATATCTTTGCCAGGAGGCTGAGTTTGTACAACTTAAAAGTTTAGAAATTCTGGGTTTTATGTATAACAATAT

ATTTTAATAAATGATATTTTATTGAAGTCTT
Translation
 - UNI4787 - - UNI10116 - - UNI14999 - MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCRS

IIEIASTGIESLPVNFALRAIIEKYQQEDHPDVVTCPEHYRQPLNVYCLLDKKLVCGHCLTIGQHHGHPIDDLQSAYLKEKDTPQKLLKQLTDTHWTDIT

RLIEKLEEQKCHSEKIVQGDKEVVLQYFKELIDTLEQKKKYFLAALCDVGKMINQEYTPQIQGMKEIREQQLELMTITTSLQDESPLKFLEKIDEVRQRV

QMLKQRPLPEVQPVEIYPRVSNVLKEEWSRIEIGRIKKAVIPEMRVSSKRTPCSWSDNDEKEMELFKILNIAIVSLISVILMLILLFNHHIITFLNEITS

ICFSEVFLSVYQSLSKNLYDLNNTVCYTLYLLKEFMWKIVSR

For any suggestions or comments, please send an email to unitrap@crg.es