Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034342 (Cbl)
Chromosomal location
Chr 9: 43957345 - 44042129 (-)
Description
Casitas B-lineage lymphoma Gene [Source:MGI Symbol;Acc:MGI:88279]
RefSeq_dna
NM_007619 
RefSeq_peptide
NP_031645.2 
UniGene
Mm.266871 Mm.401014 Mm.416155 
MGI
MGI:88279 
Uniprot/SWISSPROT
P22682 
Uniprot/SPTREMBL
Q2M4H7 Q3U527 
Human Ortholog
ENSG00000110395 (CBL)
Omim not available
UniTrap UNI2131
Vector Insertion
Chr 9: 44009291 - 44041782
Public Clones XS0447 (sanger) (sanger) AD0253 (sanger) RRR695 (baygenomics) IST14566H2 (tigm)
IST10926H11 (tigm) IST12592E7 (tigm) IST13253F7 (tigm) IST14514G3 (tigm)
Private Clones OST445466 (lexicon) OST386081 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35039
Vector Insertion
Chr 9: 43981335 - 44009291
Public Clones IST13997B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037644
Sequence
CGCGCTCGCGCCCGCGCAGGGGCGCGCCTCAGGGCGGGCGCCTCCCTCTCACTCCCTGGGCTGCGAGCGCCGGCGGTGGTTGCCGGAGAGGCCCCTCCTT

CTCGCCCGGCTCCATTCCCTCGCTCGCGGCCGAGCGGGCTCCCGACCCTCCGCTGGCCATGGCCGGCAACGTGAAGAAGAGCTCGGGCGCCGGCGGCGGC

GGCTCTGGGGGCTCGGGAGCGGGCGGCCTGATCGGGCTCATGAAGGACGCCTTCCAGCCGCACCACCACCACCACCACCTCAGCCCGCACCCTCCCTGCA

CGGTGGACAAGAAGATGGTGGAGAAGTGCTGGAAGCTCATGGACAAG - UNI2131 - - UNI35039 - GTGGTGCGGTTGTGTCAAAACCCAAAG

CTGGCGCTCAAGAACAGCCCGCCTTATATCTTAGACCTGCTGCCTGACACCTACCAGCACCTCCGCACTGTCTTGTCAAGATATGAGGGGAAGATGGAGA

CGCTTGGAGAAAATGAGTATTTCAGGGTGTTCATGGAAAATTTGATGAAGAAAACTAAGCAGACTATCAGCCTCTTCAAGGAGGGAAAAGAAAGGATGTA

TGAGGAGAATTCCCAGCCTAG - UNI35039 - GCGAAACCTGACCAAATTATCCCTGATCTTCAGCCACATGCTGGCAGAACTGAAAGGCATCTTTC

CGAGCGGACTCTTCCAAGGAGACACTTTCCGGATTACTAAAGCTGATGCTGCCGAATTTTGGAGAAAAGCTTTTGGTGAAAA - UNI35039 - GACG

ATAGTCCCGTGGAAGAGCTTTCGACAGGCCCTGCATGAAGTGCATCCCATCAGTTCTGGGCTGGAGGCCATGGCTCTGAAGTCCACTATTGATCTGACCT

GCAATGATTATATTTCTGTCTTTGAATTTGATATTTTTACACGGCTGTTTCAG CCCTGGTCCTCTTTGCTCAGAAATTGGAACAGCCTTGCTGTAACTC

ACCCTGGTTACATGGCTTTCCTGACATACGATGAAGTGAAAGCGCGCCTGCAGAAGTTCATCCACAAACCTGGCAG TTACATCTTTCGGCTGAGCTGTA

CTCGTTTGGGTCAGTGGGCTATTGGGTATGTTACTGCCGATGGGAACATTCTGCAGACAATCCCACACAATAAACCGCTCTTCCAAGCACTGATTGATGG

CTTCAGGGAAGGCTT CTATTTGTTTCCTGATGGACGAAATCAAAATCCTGACCTGACAGGTTTATGTGAACCAACTCCTCAAGATCATATCAAAGTAAC

CCAG GAACAATATGAATTATACTGTGAAATGGGCTCCACATTTCAACTGTGTAAGATATGTGCTGAGAATGATAAGGATGTGAAGATTGAGCCCTGTGG

ACACCTCATGTGCACATCCTGCCTCACGTCGTGGCAG GAATCAGAAGGTCAGGGCTGTCCTTTTTGCCGATGTGAAATCAAAGGTACTGAGCCCATCGT

GGTGGATCCGTTTGACCCCAGAGGCAGTGGCAGCCTATTAAGGCAAGGAGCAGAAGGTGCTCCTTCCCCAAATTACGACGATGATGATGATGAACGAGCT

GATGATTCTCTCTTCATGATGAAGGAGTTGGCAGGTGCCAAG GTGGAAAGGCCTTCCTCTCCATTCTCCATGGCCCCACAAGCTTCCCTTCCTCCAGTG

CCACCAAGACTTGACCTTCTACAGCAGCGAGCACCTGTTCCTGCCAGCACTTCAGTTCTGGGGACTGCTTCCAAG GCTGCTTCTGGCTCCCTTCATAAA

GACAAACCATTGCCAATACCTCCCACACTTCGAGATCTTCCACCACCACCCCCTCCAGACCGGCCTTACTCTGTTGGAGCAGAAACAAGGCCTCAGAGAC

GCCCTCTGCCTTGTACACCAGGCGATTGTCCATCTAGAGACAAACTGCCCCCTGTCCCTTCTAGCCGCCCAGGGGACTCGTGGTTGTCTCGGCCAATCCC

TAAAGTACCAGTAGCTACTCCAAACCCTGGTGATCCTTGGAATGGGAGAGAATTGACCAATCGGCACTCGCTTCCATTCTCATTGCCCTCACAAATGGAA

CCCAGAGCAGATGTCCCTAGGCTTGGAAGCACATTTAGTCTGGATACCTCTATG ACTATGAATAGCAGCCCAGTAGCAGGTCCAGAGAGTGAGCACCCA

AAGATCAAGCCTTCCTCGTCTGCCAACGCCATTTACTCTCTGGCTGCCAG GCCTCTTCCTATGCCAAAACTGCCACCTGGGGAGCAAGGGGAAAGTGAA

GAGGACACAGAATATATGACTCCCACATCTAGGCCTGTAGGGGTTCAGAAGCCAGAGCCCAAACGGCCGTTAGAGGCAACCCAGAGTTCACG AGCATGT

GACTGTGACCAGCAGATCGACAGCTGTACCTATGAAGCGATGTATAACATCCAGTCCCAAGCACTGTCTGTAGCAGAAAACAGCGCCTCTG GGGAAGGG

AATCTGGCCACAGCTCACACGAGTACTGGCCCTGAGGAATCCGAAAACGAGGATGATGGCTATGATGTGCCTAAGCCACCCGTGCCAGCTGTACTGGCCC

GCCGGACCCTGTCTGACATCTCCAATGCCAGCTCCTCCTTTGGCTGGTTGTCTTTGGATGGTGACCCTACAA ACTTCAATGAGGGTTCCCAAGTTCCTG

AGCGGCCCCCCAAACCATTCCCTCGGAGAATCAACTCAGAACGAAAAGCCAGTAGCTATCAACAAGGCGGAGGTGCCACTGCTAACCCTGTGGCCACAGC

ACCCTCACCGCAGCTCTCAAGTGAGATTGAACGCCTCATGAGTCAGGGCTATTCCTACCAGGACATTCAGAAAGCTTTGGTCATTGCCCACAACAACATT

GAGATGGCTAAAAACATCCTCCGGGAATTTGTTTCTATTTCTTCTCCTGCTCACGTAGCCACCTAGCACATCTCTCCCTGCCACGGCTTCAGAGGACCCA

TGAGCCAGGCTCTTACTCAAGGACCACCTAGGAAAGCAGTGGCTTCTTTTGGGACGTCACAGTAAGGTCCTGCCTTTCCTGTGGGGATCGACACATATGG

TTCCAAGATTTCAAAGCAGTGGAATGAAAATGGAGCAGCTGATGTGTTTCATTGTTGTATTGGTCTTAAGAGTGTTTTTGTAGTCCTGCAGTCTCCAGTA

GGAGAGAGTGGGTTTTTATTAAATGGTAACCTACCCCAGAAACAGCACAGGAAGCAGTAGCAGTGCTGTGCTGTGGCCCTAATTAAGGACTTAAGGCTTT

CCTGTTAAGGGTGTGTGTCTCTGTTGTCTGTGTGTCCTGTCATTATAAGATTATCCTGCTGTGTGTGAATCCAGGCAGGGAGTTAGCACAAGAGCTTCAG

GAAGGAATCTCTGAAGACTCCCATCTACTGTGGAATTGCACCTAGCCCTGCTGGATACTGTAACCTCAATCCTCCCCTTTGGCTTAGATTATCATGTACT

TAGCTATGTTTTATATTGTTAGAACAACCAATGTCCTTTCCCTTGGAAACTCCTTACTTCACCTCCTCCTCATTGGTGTTCTGTAGGCTTGCCGTGACCA

GTCTTACTGAAACCAAGCAGCTTATAGGATGGTCTTTCTAATGCGTGATGGTGTTGGTTTGTTTGGTAGACTAAGTGGGAAGGAAAGTACTGTTCTGTGG

CTAATTGATGCTAGCACCTAACACTGGTCACTCCAAAGTGCTGTTTCTATAGGAATGTTGAATTTGTTTTTGTTTTTGTTTTTTAAAGAAGTTTTAATTC

TCCTAGTTACCTAATGACCGATTTGAGATAGAGGCCTTCATATACATTCCGTGTCCTCCCCAGGACATAGCCTGTGGGAGTCGGTTGCCTTGATGCCAGG

TGTATGTTTCTGATGTAGGTCATGAGTGTTTCTGCCTAACAGGAACAGAACATTTGTTTCCAGGGTGGCTTTCCAACCCAAAACCATAGAGCTTTTAGGA

AGCGTCAGTCATATATAGATTTACAAAATAAACAGCTAGGACTTATCTGTTTAGTCTTTCTTGCCAGTGGCTAACTTCAGCTTAGGAATTTCTCCCTTGA

ATGGGAGCCAGGTAAGCCTTTCAGAAATGATTTCTTCTTTTGCCCTGTGAGGAACGGAGCTAACACCAGTGAGGACAGCATTTGCTGATGGCTTCTCTAG

ATTGGTGCACCCAGTGACTTGGTTGTCCATGTGCCTAGCTTGTGCTTTGGAATGGTTTCTCTTTCCTTTTCCTTGCCTTTTTTATTGGGTCCTAGATGTA

ACCGCTGTGTCATCCATCTACAGTATTTAGTTATCATTCATTGGAATTCTTTAGCTAGACGGTTTGGAACAGTGTAATAGTTTGTGTATTTACAGGTTCA

TCAAGGAGATGTAATTTGTTTTGGAGAGTCCGTTTCTACGTCATCGTAGTGACCTCTTGGGTTCAGTTTGTTCTCTGACTGGAGTCTTGCTGGCTTCTCT

GACAGCGTTGCCCTTTCTCCTGTTGAGTACGAGCTGGCTTTTACATGAATCCTCTCTGTTCTTTAGGTCCAGGCAGAAATGACCCACCAAGAATCTGCTT

TCTTTCCAGTCTTTTGCAACAAAAATCTTTTGAACTCTTCTTTTAGTTTCTTGATGCTTCAAGGTCTGGATTTTATCCTCTTACCTTAAGGCTATTCGAA

AGGCAGATACGGTATCTATGGCTACCCAGTGTCTTCTCTACATAGCAATGAGTAGAAAACAATAGCTTGTCATCCACAAAAAGTTTGTGATATCCAATTT

TGTGTTCATTTGAATACTGAAAGCCTAAGCCAGGCTTGGTGGCATCTCAGCACCTGAGAGATGGTGGCAAGATGATCAGGAGTTCAGCACCAGCTCAAAG

CTCCTGAAACCCTGTCTCAAAAATAACAGGGGTTAAAGAGATGACTTCAGTTCAGAGCAGCTCTTCTTGCAGAGGACCTAGGTTTGGTTCCTAGCACCCA

CATGAAAGGTTTCTCAGATGTATAAGCAACTCACAACCATCTATAACTTCAGTTCAGAGCAATCTGATGCCCTCTTCTGGCTTCTGTGGGCACCAGGCAC

ACATACGATGTACATATATACAGGCAGGTAGAGCATTAAATAAATACAT
Translation
MAGNVKKSSGAGGGGSGGSGAGGLIGLMKDAFQPHHHHHHLSPHPPCTVDKKMVEKCWKLMDK - UNI2131 - - UNI35039 - VVRLCQNPKLA

LKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQPR - UNI35039 - RRNLTKLSLIFSHM

LAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEK - UNI35039 - KTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTR

LFQ PWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGS SYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGF FYLFPD

GRNQNPDLTGLCEPTPQDHIKVTQ EQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQ ESEGQGCPFCRCEIKGTEPIVVDPFDPRGS

GSLLRQGAEGAPSPNYDDDDDERADDSLFMMKELAGAK VERPSSPFSMAPQASLPPVPPRLDLLQQRAPVPASTSVLGTASK AASGSLHKDKPLPIPP

TLRDLPPPPPPDRPYSVGAETRPQRRPLPCTPGDCPSRDKLPPVPSSRPGDSWLSRPIPKVPVATPNPGDPWNGRELTNRHSLPFSLPSQMEPRADVPRL

GSTFSLDTSM TMNSSPVAGPESEHPKIKPSSSANAIYSLAAR RPLPMPKLPPGEQGESEEDTEYMTPTSRPVGVQKPEPKRPLEATQSSR RACDCDQ

QIDSCTYEAMYNIQSQALSVAENSASG GEGNLATAHTSTGPEESENEDDGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLDGDPTN NFNEGSQVPE

RPPKPFPRRINSERKASSYQQGGGATANPVATAPSPQLSSEIERLMSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVAT

For any suggestions or comments, please send an email to unitrap@crg.es