Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034412 (Tbc1d10a)
Chromosomal location
Chr 11: 4086792 - 4115505 (+)
Description
TBC1 domain family, member 10a Gene [Source:MGI (curated);Acc:Tbc1d10a-001]
RefSeq_peptide
NP_598784.1 
UniGene
Mm.400807 Mm.471313 
MGI
MGI:2144164 
Uniprot/SWISSPROT
P58802 
Uniprot/SPTREMBL
Q3US32 Q571E6 Q5SPX8 Q8CI62 Q8K2U6 
Human Ortholog
ENSG00000099992 (TBC1D10A)
Omim not available
UniTrap UNI3139
Vector Insertion
Chr 11: 4110037 - 4112143
Public Clones XR0234 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000041042
Sequence
ATGGGCACAGTGCGTGGGAGGGGCGTCGGCAGCGTCGGCGGAGGCCGGGCGGCTCAGGCGGCTGAGGTGGCCGCTGGCGCTCTGGTGGCGGGCGCGGCCG

ATATGGCGAAAAGCAGCAGAGAGAATGGGCCGCGCGAGCCCGCAGCAGGCGGGAGCCTGTCTGGGACCCGGGAAAGCCTGGCCCAGGGCCCCGACGCCGC

CACCGCCGACGAGCTGAGCTCGCTCGGCTCCGACTCGGAGGCCAACGGCTTCGCCGAGCGCCGCATCGACAAGTTCGGATTCATCGTGGGTTCGCAGGGC

GCCGAGGGCGC ACTGGAGGAAGTTCCCCTGGAGGTGCTGAGGCAGAGGGAGTCCAAGTGGCTGGACATGCTCAACAACTGGGACAAATGGATGGCCAAG

AAGCACAAAAAG ATTCGTCTTCGATGCCAGAAGGGCATCCCACCTTCTCTGCGCGGACGGGCTTGGCAGTACCTGTCGGGAGGCAAGGTGAAACTTCAG

CAGAACCCTGGGAAGTTTGAT - UNI3139 - GAGCTGGACATGTCTCCTGGGGACCCCAAGTGGCTAGATGTGATTGAGCGTGACCTGCACCGGCAG

TTCCCATTCCATGAGATGTTCGTGTCCCGAGGAGGCCATGG CCAGCAGGACCTGTTCCGTGTGCTGAAGGCCTACACGCTGTACCGCCCTGAGGAGGGC

TACTGCCAGGCGCAGGCACCCATTGCTGCTGTGCTCCTCATGCACATGCCTGCTGAG CAAGCCTTCTGGTGTCTGGTACAAGTCTGTGAGAAGTACCTG

CCTGGCTACTACAGTGAGAAACTG GAGGCAATCCAGCTGGACGGCGAGATCCTCTTCTCACTGCTACAGAAGGTGTCCCCTGTGGCTCACAAGCACCTC

AGCCGCCAGAAGATTGATCCCCTGCTGTACATGACAGAGTGGTTCATGTGTGCTTTTGCCCGCACGCTGCCCTGGAGCTCTGTGCTGCGAGTTTGGGACA

TGTTCTTTTGTGAAG GAGTCAAGATCATCTTCCGCGTGGGGCTGGTACTACTGAAGCATGCACTGGGCTCCCCAGAGAAGCTCAAAGCCTGCCAGGGCC

AGTATGAAACCATCGAGCAGCTGCGGAGCCTCAGCCCCAAGATCATGCAGGAAGCCTTCCTGGTTCAGGAG GTGATAGAGCTGCCTGTGACGGAGCGCC

AGATTGAGCGGGAGCACCTCATCCAGCTGCGGCGCTGGCAAGAGACGCGTGGTGAGCTGGAGTGCCGCTCTCTGCCCAGGATGCATGGTGCCAAAGCCAT

CCTGGATGCAGAGCCTGGTCCCAGGCCTGCCCTGCAACCTTCACCTTCCATCCGCCTACCGCCAGATGCAGCCCTCCTCAGCTCCAAGGCTAAGCCGCAC

AAGCAGGCCCAGAAGGAGCAGAAGCGGACAAAGACCAGTGCGCAACTGGACAAGTCCCCAGGCCTCAGTCAAGCCACAGTGGTGACTGCTGCAGGAGATG

CATGTCCTCCTCAGGGTGTGTCCCCAAAGGACCCGGTCCCCCAGGACCCTACTCCTCAGAACTTAGCCTGCCACCATTCCCAGGAGAGCCTGACCTCCCA

GGAGAGTGAGGACACCTACTTGTAACCCCGGGAGCTCAGGCCTCCGCGGGGGTCTTCTCACGTCTTACACGGTTCAAAGACTGACAACACTCCAGGTCCT

CTGCGCCTGAGGAGCCAACTGCTTGGCCCGTGGGCTGGGATAGGATCTGGCTGGTCCAGTACAGAGTCTGCCTGGGCCTCCTTATTTATTTTCTCTTGAG

TTGAGCTGGTCCAGCCAGCACAGGCAGAAGCTGTGGCCAAAGGGGTTGGGTCTCAGCCCCATCCTTCTGGGGAGATGTTACCCAGGGGTAGGGTGCTGGC

ATGCGGGGAGGCGGTGGGGTACTCTTTGTGTAAAATAGATATATGGTTTTGTACGGAAATAAACAGGCTTGTGT
Translation
MGTVRGRGVGSVGGGRAAQAAEVAAGALVAGAADMAKSSRENGPREPAAGGSLSGTRESLAQGPDAATADELSSLGSDSEANGFAERRIDKFGFIVGSQG

AEGA ALEEVPLEVLRQRESKWLDMLNNWDKWMAKKHKK IRLRCQKGIPPSLRGRAWQYLSGGKVKLQQNPGKFD - UNI3139 - ELDMSPGDPKW

LDVIERDLHRQFPFHEMFVSRGGHG GQQDLFRVLKAYTLYRPEEGYCQAQAPIAAVLLMHMPAE QAFWCLVQVCEKYLPGYYSEKL EAIQLDGEILF

SLLQKVSPVAHKHLSRQKIDPLLYMTEWFMCAFARTLPWSSVLRVWDMFFCEG GVKIIFRVGLVLLKHALGSPEKLKACQGQYETIEQLRSLSPKIMQE

AFLVQE VIELPVTERQIEREHLIQLRRWQETRGELECRSLPRMHGAKAILDAEPGPRPALQPSPSIRLPPDAALLSSKAKPHKQAQKEQKRTKTSAQLD

KSPGLSQATVVTAAGDACPPQGVSPKDPVPQDPTPQNLACHHSQESLTSQESEDTYL

For any suggestions or comments, please send an email to unitrap@crg.es