Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034442 (Trmt5)
Chromosomal location
Chr 12: 74380999 - 74387694 (-)
Description
TRM5 tRNA methyltransferase 5 homolog (S. cerevisiae) Gene [Source:MGI Symbol;Acc:MGI:1923607]
RefSeq_dna
NM_029580 
RefSeq_peptide
NP_083856.1 
UniGene
Mm.311344 
MGI
MGI:1923607 
Uniprot/SWISSPROT
Q9D0C4 
Human Ortholog
ENSG00000126814 (TRMT5)
Omim not available
UniTrap UNI18915
Vector Insertion
Chr 12: 74386263 - 74387670
Public Clones not available
Private Clones OST411052 (lexicon) OST377852 (lexicon) OST306634 (lexicon) OST187666 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000055255
Sequence
GAGCTGCACCAGAGCATGAG - UNI18915 - AATCGTATGGAAGCTATTTGGATTCTCAAGAAGACTTTTGCAAGTGGAATGGTGTCACCCCAGTGA

ATCAATATTGTTGTTTACCCTGGTGCCGAGACTTAGGAAAGCGCCTTCTGTTTTCTTGTTGGGTCAAAGACAAGGACTCTCAACCATGCCAGAAATAGAA

GCAAGTGTGAGAGATAGTGAATTATTTTCACCACCCTCTGACGTTCGAGGAATGAGAGAACTTGATAGAACAGCTTTTAAGAAGACAGTGTCCATCCCTG

TGCTTAAAGCGAGGAAAGAAGTAGTCAACAGATTGATGCGAGCCCTCAGGAGAGTAGCCCTGCAGCGCCCGGGCATAAAGCGAGTGATTGAGGATCCCAA

GGATGAAGACAGTAGGCTGATCATGTTGGACCCCTACAGGATGCTTACTGCTGATTCCTTTGACAAAGCAGAACTCGGAGTTTTAAAAGAACTTGATGTC

AGCCCACAGTTATCCCAGTACAACTTGGAACTAACATATGAAAATTTTAAGTCAGAAGAAATTTTGAAAGCTGTGCTTCCTGAAGGTCAAGATGTAACCT

CTGGATTCAGCAGGGTTGGGCATATTGCACACCTGAATCTCCGAGATCACCAGCTGCCCTTCAAGCATTTAATTG GCCAAGTTATGGTTGACAAAAACC

CAGGAATCACCTCAGCAGTAAATAAAACCAGCAACATTGACAATACGTACCGAAATTTCCAAATGGAAGTGCTGTGTGGAGAGGAAAATATGCTGACCAA

G GTTCGAGAAAACAACTACACGTATGAGTTTGATTTCTCTAAAGTCTACTGGAATCCTCGTCTCTCTACTGAACATGGCCGGATCACTGAACTTCTCAA

CCCTGGAGATGTCTTGTTTGATGTTTTTGCTGGGGTTGGGCCCTTTGCCATTCCAGCAGCAAGGAAAAACTGCACAGTGTTTGCCAATGATCTCAATCCT

GAGTCCCATAAATGGCTGTTGCACAATTGTAAACTGAATAAAGTTGACCAGAAAGTGAAAGTCTTTAACATGGATGGAAAAGACTTCATCCAAGGGCCAG

TCAGAGAAGAGTTAATGCTTCGGCTAGGATTGTCAGCTGAAGCTAAACCCTCTGTCCACATTGTCATGAACTTGCCAGCTAAGGCCATAGAGTTTCTCAG

TGTTTTCAGATCACTTTTGGATGGGCAGCCTTGCAGCACGGAGCTCCTCCCCACAGTGCACTGTTACTGCTTCTCCAAAGATAGCGATCCTGCTAAGGAT

GTTCGTCAGCAGGCGGAAGCTGTGCTGGGCGTTTCCTTGGAGACCAGTAGTTCAGTTCATCTCGTAAGGAATGTGGCCCCTAACAAGGAGATGCTGTGCA

TCACCTTCCAGATTCCCACTGCTACACTCTACAGGAACCAAAGCCTCAGTCTAC AGAATGACCAAGAACCACCTCTTAAACGGCAGAAGACAGGTGACC

CGTTCTCAGGAGAACCACAGATCGCATCAGATTCTTAGTTTGAAATGTTTTCTCCATCTCCCCAGTAGACTTTATGTAAAGAAGTACAATTTGTAAGAGG

TAAACTCTACCACACAGATATTTGTTACTAAACACTTACGATTTGCTCTTATAAATGGAACATTACCAAAGTAAACTGAAATAAGAGGAACTTGGATATT

GTATAGACTGATTTTTTGTTTCCATCCATTTTTCCTTTCTTTTTTATTATTTTTTGTGGCAGGATCTGTGTAACTCAGGGCTTAGAACTCTATCTTCCTG

CTTCAGCCTCCCAGCTGTTGGCATTTCCAGCGTGCACCGCTGTTATTCAGCATAGTTTTAAAACAGAATCGGCATGGGCCAGTCAGACCAGTCAGATGGC

TCACTGGGTGAAGGCACTTGCTGCCAAGCCTGATAGCCTGAGCCTGCCTAGGAACAACGTGGAAAGGAAGAAATCCTGAAAGTCTTCTTCTGACCTCATG

CGTGCACCAAGGTACTCATGTATACACTTGCACAAAATAAGCGAACAAATTAATAAACTTGGAAATTTATGTAAGG
Translation
MR - UNI18915 - RIVWKLFGFSRRLLQVEWCHPSESILLFTLVPRLRKAPSVFLLGQRQGLSTMPEIEASVRDSELFSPPSDVRGMRELDRTAFKK

TVSIPVLKARKEVVNRLMRALRRVALQRPGIKRVIEDPKDEDSRLIMLDPYRMLTADSFDKAELGVLKELDVSPQLSQYNLELTYENFKSEEILKAVLPE

GQDVTSGFSRVGHIAHLNLRDHQLPFKHLIG GQVMVDKNPGITSAVNKTSNIDNTYRNFQMEVLCGEENMLTK VRENNYTYEFDFSKVYWNPRLSTEH

GRITELLNPGDVLFDVFAGVGPFAIPAARKNCTVFANDLNPESHKWLLHNCKLNKVDQKVKVFNMDGKDFIQGPVREELMLRLGLSAEAKPSVHIVMNLP

AKAIEFLSVFRSLLDGQPCSTELLPTVHCYCFSKDSDPAKDVRQQAEAVLGVSLETSSSVHLVRNVAPNKEMLCITFQIPTATLYRNQSLSLQ QNDQEP

PLKRQKTGDPFSGEPQIASDS
Transcript ENSMUST00000116420
Sequence
TTCCGAGCTGCACCAGAGCATGAG - UNI18915 - AATCGTATGGAAGCTATTTGGATTCTCAAGAAGACTTTTGCAAGTGGAATGGTGTCACCCCA

GTGAATCAATATTGTTGTTTACCCTGGTGCCGAGACTTAGGAAAGCGCCTTCTGTTTTCTTGTTGGGTCAAAGACAAGGACTCTCAACCATGCCAGAAAT

AGAAGCAAGTGTGAGAGATAGTGAATTATTTTCACCACCCTCTGACGTTCGAGGAATGAGAGAACTTGATAGAACAGCTTTTAAGAAGACAGTGTCCATC

CCTGTGCTTAAAGCGAGGAAAGAAGTAGTCAACAGATTGATGCGAGCCCTCAGGAGAGTAGCCCTGCAGCGCCCGGGCATAAAGCGAGTGATTGAGGATC

CCAAGGATGAAGACAGTAGGCTGATCATGTTGGACCCCTACAGGATGCTTACTGCTGATTCCTTTGACAAAGCAGAACTCGGAGTTTTAAAAGAACTTGA

TGTCAGCCCACAGTTATCCCAGTACAACTTGGAACTAACATATGAAAATTTTAAGTCAGAAGAAATTTTGAAAGCTGTGCTTCCTGAAGGTCAAGATGTA

ACCTCTGGATTCAGCAGGGTTGGGCATATTGCACACCTGAATCTCCGAGATCACCAGCTGCCCTTCAAGCATTTAATTG GCCAAGTTATGGTTGACAAA

AACCCAGGAATCACCTCAGCAGTAAATAAAACCAGCAACATTGACAATACGTACCGAAATTTCCAAATGGAAGTGCTGTGTGGAGAGGAAAATATGCTGA

CCAAG GTTCGAGAAAACAACTACACGTATGAGTTTGATTTCTCTAAAGTCTACTGGAATCCTCGTCTCTCTACTGAACATGGCCGGATCACTGAACTTC

TCAACCCTGGAGATGTCTTGTTTGATGTTTTTGCTGGGGTTGGGCCCTTTGCCATTCCAGCAGCAAGGAAAAACTGCACAGTGTTTGCCAATGATCTCAA

TCCTGAGTCCCATAAATGGCTGTTGCACAATTGTAAACTGAATAAAGTTGACCAGAAAGTGAAAGTCTTTAACATGGATGGAAAAGACTTCATCCAAGGG

CCAGTCAGAGAAGAGTTAATGCTTCGGCTAGGATTGTCAGCTGAAGCTAAACCCTCTGTCCACATTGTCATGAACTTGCCAGCTAAGGCCATAGAGTTTC

TCAGTGTTTTCAGATCACTTTTGGATGGGCAGCCTTGCAGCACGGAGCTCCTCCCCACAGTGCACTGTTACTGCTTCTCCAAAGATAGCGATCCTGCTAA

GGATGTTCGTCAGCAGGCGGAAGCTGTGCTGGGCGTTTCCTTGGAGACCAGTAGTTCAGTTCATCTCGTAAGGAATGTGGCCCCTAACAAGGAGATGCTG

TGCATCACCTTCCAGATTCCCACTGCTACACTCTACAGGAACCAAAGCCTCAGTCTAC AGAATGACCAAGAACCACCTCTTAAACGGCAGAAGACAGGT

GACCCGTTCTCAGGAGAACCACAGATCGCATCAGATTCTTAGTTTGAAATGTTTTCTCCATCTCCCCAGTAGACTTTATGTAAAGAAGTACAATTTGTAA

GAGGTAAACTCTACCACACAGATATTTGTTACTAAACACTTACGATTTGCTCTTATAAATGGAACATTACCAAAGTAAACTGAAATAAGAGGAACTTGGA

TATTGTATAGACTGATTTTTTGTTTCCATCCATTTTTCCTTTCTTTTTTATTATTTTTTGTGGCAGGATCTGTGTAACTCAGGGCTTAGAACTCTATCTT

CCTGCTTCAGCCTCCCAGCTGTTGGCATTTCCAGCGTGCACCGCTGTTATTCAGCATAGTTTTAAAACAGAATCGGCATGGGCCAGTCAGACCAGTCAGA

TGGCTCACTGGGTGAAGGCACTTGCTGCCAAGCCTGATAGCCTGAGCCTGCCTAGGAACAACGTGGAAAGGAAGAAATCCTGAAAGTCTTCTTCTGACCT

CATGCGTGCACCAAGGTACTCATGTATACACTTGCACAAAATAAGCGAACAAATTAATAAACTTGGAAATTTATGTAAGG
Translation
SELHQSMR - UNI18915 - RIVWKLFGFSRRLLQVEWCHPSESILLFTLVPRLRKAPSVFLLGQRQGLSTMPEIEASVRDSELFSPPSDVRGMRELD

RTAFKKTVSIPVLKARKEVVNRLMRALRRVALQRPGIKRVIEDPKDEDSRLIMLDPYRMLTADSFDKAELGVLKELDVSPQLSQYNLELTYENFKSEEIL

KAVLPEGQDVTSGFSRVGHIAHLNLRDHQLPFKHLIG GQVMVDKNPGITSAVNKTSNIDNTYRNFQMEVLCGEENMLTK VRENNYTYEFDFSKVYWNP

RLSTEHGRITELLNPGDVLFDVFAGVGPFAIPAARKNCTVFANDLNPESHKWLLHNCKLNKVDQKVKVFNMDGKDFIQGPVREELMLRLGLSAEAKPSVH

IVMNLPAKAIEFLSVFRSLLDGQPCSTELLPTVHCYCFSKDSDPAKDVRQQAEAVLGVSLETSSSVHLVRNVAPNKEMLCITFQIPTATLYRNQSLSLQ 

QNDQEPPLKRQKTGDPFSGEPQIASDS

For any suggestions or comments, please send an email to unitrap@crg.es