Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034452 (Slc24a1)
Chromosomal location
Chr 9: 64770668 - 64799414 (-)
Description
solute carrier family 24 (sodium/potassium/calcium exchanger), member 1 Gene [Source:MGI Symbol;Acc:MGI:2384871]
RefSeq_dna
NM_144813 
RefSeq_peptide
NP_659062.1 
UniGene
Mm.156124 
MGI
MGI:2384871 
Uniprot/SPTREMBL
Q91WD8 
Human Ortholog
ENSG00000074621 (SLC24A1)
Omim not available
UniTrap UNI26769
Vector Insertion
Chr 9: 64783831 - 64785041
Public Clones not available
Private Clones OST98671 (lexicon)
Severity of mutation (?) Insertion after 54% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30645
Vector Insertion
Chr 9: 64779973 - 64783831
Public Clones IST12299D1BBF1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 58% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037798
Sequence
AGGATTCCTAAGGGAGCCGGCAGGAGGAGAATGGGGTGTTCCTTGTGGTTCCACTTCACACCTACTCTTCGAGACCCCGGATTCTGACAAGTTTCCCGAA

CTTGGAAGACCCAGATGTCAAGGTCTGAAG GTTTGGGGATACCCCCAGGCTGGGCTTCATGGAGAAACCTTTCCTGATTACTAACATGAATCCCAGAGC

AGCCTCTGCCTCTCCCTGGACAGGATGAGAGGCCAACTGTAACCAGACCTAACCGGCCATCATGGGGAAACTGATCAGGATGGGGACACAGGAGAGGCGG

TTACTCCGACCAAAGAGGCTTCATTGGAGTCGCCTTCTTTTCCTCTTGGGAATGTTGATCATTGGCTCTACTTATCAGCACCTGAGGAGACCCCAGAATC

CCCCCTCAATGTGGACAAAGGTCTCCTCCCAGCAGCCTATTAAACTGGCCGTCAGGGACCTCCCCAACAATGAAATGGCAGTGGCAGGCAGTGACCCTCC

AGAGGCTAGCTCTGAAGTGGAGGATGGGATGCTAGCAGCCCAAGACACAGTGATCATGGATGAAGCAGCACCTAGCATAGCAATGGAGGACACCCCCAAT

CCACCCAGAACAACCAAGATCCCTCCAGCATCACTAAAGAACAGTTATAGCCCTACAACAGCTGGCACAAGAAGACAAAAAGAAAACATCCCACCCACAC

CTAGTGGAGCACCAAGTCACTTCATCTCAACTCCAGGCAGACAGAGGGTAAAAAGCTATATCCCAAAACCCAGGGGAGAAAGGAAGAACTCCAGCCCAAC

TCACGCCAGGGAAAAAGGAAGGACGCATACCCCATCTCCAGCAGGTGCTCACACCATCAGCCCCACAGCAACTGTGAGAGACAGAGAAACCATGGCAACC

TATAGGCTGTTAGAGACCAGATTTGAGAGAACAGCAGGAGAAACCACAGCAGCTTCTCTCAAGAGAATGGTTCTGAACACACCGACCTTCTTAACACATG

AAGTAGAAACAAACCTCATGACTTCTTCAAGTTTGGTGGGAAAGAACACTGCGGTAAGTCTTAGAAAAGGGGAAAGAAACATCTCTACCACTCCCCAGGG

AGCGGTCCCACAGCACACCCCTGCCACCTCTGAGGAGCAAATGACAGTAAGCACCAGGATGGGTAGCATCCCAGCCACCATCGAAGGCTCTACTGCTGCC

CGGAGAATTAACAATCCCTTGTCCAGAACCAGTGCACCAGCCATTAGAATTGCCTCGGCCACCAACAGGGAAAAGAGACCTTCTACAGCACCCAGCACCC

TCGTAACTCCCAAGGCAACCATGAGCACACAAGTCCACCGATGTGTGGTTGTGGAGCCAGCCCCAGCTGTACCCATGACCCCATCTCCAGGCGTGACAAG

CATCCTGTTCCCAGAGACACCCAGTTCCGGTCCCTCGGCTTTGCCACCCGGCTGGCCAAATCTCCACCCCAAGGCGGAGTATCCCCCAGACCTGTTCAGT

GTGGAGGATCGACGACAGGGCTGGGTGGTCCTACACATCTTCGGCATGATGTATGTGTTCGTGGCCTTGGCCATCGTGTGCGACGAGTACTTTGTCCCAG

CCTTGGGAGTCATCACACACAAGCTGCAGATCTCCGAGGATGTGGCAGGGGCCACATTCATGGCTGCCGGAGGCTCGGCCCCGGAGCTCTTCACCTCTCT

CATTGGTGTCTTTATCTCCCACAGCAATGTGGGTATTGGTACCATCGTGGGCTCTGCTGTGTTCAACATCCTTTTTGTCATCGGCACCTGTGCCCTCTTC

TCCCGGGAGATCCTCAACCTCACCTGGTGGCCCCTGTTCCGAGACGTCTCCTTCTACATCCTTGACTTGTCTATGCTCATTGTCTTCTTCCTGGACAGTT

TCATTGCCTGGTGGGAGAGCCTGCTGCTGCTGTTGGCCTACGCTCTCTATGTGTTCACCATGAAGTGGAACAAGCAGATTGAGCTCTGGGTGAAAGAGCA

GCTTAGCAGGAGGCCCGTAGCCAAAGTCATGGCCCTGGGAGACCTCAGCAAG CCCAGTGAGGATGCTGTCGAGGAAAACGAGCAACAGGACAGCAAGAA

ACTGAAG - UNI26769 - - UNI30645 - CTCCCGTCTGTGCTGACCCGAGGGAGTAGCTCGGCCTCGCTGCACAACAGTATCATCCGCAACACC

ATCTACCACCTCATGCTCCACAGCCTGGACCCCCTGGGGGAAG - UNI30645 - CCCGCCCCTCCAAGGACAAGCAGGAGAGCTTGAATCAGGAAGC

CAGAGTTCTCTCCCAGACCAAAGCAGAAAGCAGCCCAGACG - UNI30645 - AGGATGAGCCAGCCGAGCTCCCTGCGGTCACGGTCACTCCAGCCC

CTGCTCCAGACGCCAAGGGAGATCAGGAGGACGATCCAGGCTGCCAG GAAGATGTGGATGAGGCTGAACGCAGAGGAGAAATGACAGGTGAAGAGGGTG

AAAAGGAAACCGAGACGGAAGGAAAAAAAGATGAACAAGAAGGGGAAACTGAGGCAGAAAGGAAAGAAGATGAGCAAGAAGAAGAAACTGAGGCAGAAGG

AAAAGAACAAGAAGGGGAAACTGAGGCAGAAGGAAAAGAAGATGAACAAGAAGGGGAAACAGAGGCAGAAGGCAAAAAAGATGAACAAGAAGGGGAAACT

GAGGCAGAAGGCAAAGAGGAACAAGAAGGGGAAACTGAGGCAGAAGGAAAAGAAGATGAACAAGAAGGGGAAACTGAGGCAGAAGGCAAAGAGGAACAAG

AAGGGGAAACTGAGGCAGAAAGCAAAGAAGTTGAACAAGAAAGGGAAACTGAGGCAGAAGGCAAAGATAAGCATGAAGGGCAAGGTGAAACCCAACCAGA

CGACACTGAGGTGAAAGATGGTGAGGGTGAAACAGAAGCCAATGCTGAAGATCAATGTGAGGCCACCCAAGGTGAGAAGGGTGCAGATGGTGGAGGGGAA

AGTGATGGAGGGGACAGTGAGGAAGAGGAGGATGAAGAAGATGAAGAGGAGGAAGAGGAGGAAGATGAGGAAGAGGAGGAGGAGGAAAATGAGGAGCCTC

TGTCTCTGGAATGGCCTGACAGCAGGCAGAAGCAGGCCATCTACCTCTTCCTCCTGCCCATCGTGTTCCCACTGTGGCTGACAATACCTGATGTACGGAG

GCAG GAGTCCAGGAAGTTTTTTGTCATCACCTTCCTGGGATCCATCATCTGGATAGCCATGTTCTCATACCTCATGGTATGGTGGGCTCACCAG GTTG

GCGAAACCATTGGGATTTCTGAAGAGATTATGGGTTTGACAATCTTAGCAGCAGGCACTTCAATTCCTGACCTCATCACCAGTGTGATCGTTGCCCGGAA

AGGCCTGGGAGACATGGCTGTGTCAAGCTCAGTGGGCAGTAACATATTTGACATCACAGTGGG CTTGCCTGTTCCGTGGCTCCTCTTCTCCCTCATCAA

TGCGCTGCAGCCTGTTCCTGTCAGCAGCAACGGCCTGTTCTGTGCAATCGTCTTGCTGTTTCTCATGCTCCTGTTTGTGATCTTCTCAATTGCATCGTGT

AAATGGAGAATGAACAAGATCCTGGGCTTCACGATGTTCCTTCTTTACTTTGTGTTCTTGGTAATCAGTGTGATGTTAGAAGATCGAATCATATCCTGCC

CTGTGTCTGTCTGATTCAGCCACTGATGCTCAAGATGGACATAGAGGAGAGGACTATGCCAGAAGTTACCGTCCCTCTTACCATACCAATCAAATAATGA

ACATGATCAGGAATGTGAGCCGGGCAGCGTAGACCCTCAGAGGTGACTGTCATTATGACTGAGGCTTCTCTCTGCAAACACCTGCAGCTTCAGGTGGATT

AAGAACGTTACCTTGGAAGGGAGAGTTTTTATCACTCAGGCAAGCAGCTGTCATGCAGTCAGAGGACTTCCTGTATGAGACCTGAAGTTACAGTTGGGAT

GGCAGAAATTAGACAAGTACCCTTGCTCACAATTCCCTTGTCACTCCTGAAGAGCCATGGTGCAGCATGCAGGGGTCAAAGGCTTGTTCTCCTGAACACT

GCCCTAAACACACACTGCCACACGCTATTTATTCCTCCTGGTGGAATTGTGAAGCCACATCAGGTTTGCTGTCATTGTGAGTTCAGTTAATGAGTTTAAG

AAGGGAAGGCTTGGAGGCAGGGGCAGGAATAAATTTATCATTCTACCCCACAGTCCTGTGAAAACGCATGCCAATGCTTTCTGTGTCAAAAGGAAGATAA

TAGCTTTTATTGTTGCATTTCTGAAAAATGAAATTAGAACAGAAAGCAGCCTAGGGAATGAAAGTCTGTAATTTGACTTGAATTGGAGGCAAGGATTTGA

GGAAGAAAACTACTCTTAGGGCTATGTAAACATATGCACTTCCTGGAAAATCCACATTTGTTTGTCTCCATCAGTGGCCACTTCAAAGGATTATTCTGAC

ACAGCTGCCCTGCTGCCCTTGGGCATTTTCTTGCCCAGGAGTGACAACTGTCACTGAAGAGCCAAAGGGATGCATTTGCAGAGGGCCAAATCTGGCGGAT

GCATGAAGAGATCTAGGGCTCAGTGCTATGCTTATATGCCAACCTAGACTAGACTGTAAAGCAAGAAGGCTAGTCCTTTGAATAGTTTATCAGTGGGTCT

TAAGAGAGTTTACAAAGGAGAAATTTCAAAACTGCTTAGCGCAATGACGACACAGCAAGAAATGAAAGAGTACTGCTCGTTACACAGACCAGGCTGGCCT

TGGAGTCACACACCTACCTGCCCCTGCCTCCTGAGTGCCGGGATTAAAAGATGGCCACTACATCTGGTTGAGTATGTATTTTTAAGGGCACAAAGGATAC

CTTAAGAAGTCATGGTTAAATATTTTCGATGACGTTTCACATGCTTGCATATTAACTATCTTTGGCCACTGCTTTTCCTACAATCAAGCTGAGGAGAATG

TTAGAAATAAAACTTTCACGTCTTTGGTTTCAGAGCACAAGGAACATGAGCGTCTGCAGATTATGATGCAAATGATGTATGTCATAGACACCAGGAGTGA

TGTGGTAGCCTGTGAGAAAATAGTGGGGTGGGTGGGAAAGAAAAGCAATGGTTCATTCTGGTGATGGAGGGTGGAGGTACTCAAGTATTCATCTTTTAAG

ATGGGCTGTACTTCTTCAAAATTCCCATTTTTTTGGAAGTAACTTTTATTAAATTTCAATGAAAACTGTGGGTC
Translation
 MGKLIRMGTQERRLLRPKRLHWSRLLFLLGMLIIGSTYQHLRRPQNPPSMWTKVSSQQPIKLAVRDLPNNEMAVAGSDPPEASSEVEDGMLAAQDTVIM

DEAAPSIAMEDTPNPPRTTKIPPASLKNSYSPTTAGTRRQKENIPPTPSGAPSHFISTPGRQRVKSYIPKPRGERKNSSPTHAREKGRTHTPSPAGAHTI

SPTATVRDRETMATYRLLETRFERTAGETTAASLKRMVLNTPTFLTHEVETNLMTSSSLVGKNTAVSLRKGERNISTTPQGAVPQHTPATSEEQMTVSTR

MGSIPATIEGSTAARRINNPLSRTSAPAIRIASATNREKRPSTAPSTLVTPKATMSTQVHRCVVVEPAPAVPMTPSPGVTSILFPETPSSGPSALPPGWP

NLHPKAEYPPDLFSVEDRRQGWVVLHIFGMMYVFVALAIVCDEYFVPALGVITHKLQISEDVAGATFMAAGGSAPELFTSLIGVFISHSNVGIGTIVGSA

VFNILFVIGTCALFSREILNLTWWPLFRDVSFYILDLSMLIVFFLDSFIAWWESLLLLLAYALYVFTMKWNKQIELWVKEQLSRRPVAKVMALGDLSK P

SEDAVEENEQQDSKKLK - UNI26769 - - UNI30645 - LPSVLTRGSSSASLHNSIIRNTIYHLMLHSLDPLGEA - UNI30645 - ARPSK

DKQESLNQEARVLSQTKAESSPDE - UNI30645 - EDEPAELPAVTVTPAPAPDAKGDQEDDPGCQ EDVDEAERRGEMTGEEGEKETETEGKKDEQ

EGETEAERKEDEQEEETEAEGKEQEGETEAEGKEDEQEGETEAEGKKDEQEGETEAEGKEEQEGETEAEGKEDEQEGETEAEGKEEQEGETEAESKEVEQ

ERETEAEGKDKHEGQGETQPDDTEVKDGEGETEANAEDQCEATQGEKGADGGGESDGGDSEEEEDEEDEEEEEEEDEEEEEEENEEPLSLEWPDSRQKQA

IYLFLLPIVFPLWLTIPDVRRQ ESRKFFVITFLGSIIWIAMFSYLMVWWAHQ VGETIGISEEIMGLTILAAGTSIPDLITSVIVARKGLGDMAVSSSV

GSNIFDITVG GLPVPWLLFSLINALQPVPVSSNGLFCAIVLLFLMLLFVIFSIASCKWRMNKILGFTMFLLYFVFLVISVMLEDRIISCPVSV

For any suggestions or comments, please send an email to unitrap@crg.es