Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034453 (Polr3b)
Chromosomal location
Chr 10: 84085182 - 84189922 (+)
Description
polymerase (RNA) III (DNA directed) polypeptide B Gene [Source:MGI Symbol;Acc:MGI:1917678]
RefSeq_dna
NM_027423 
RefSeq_peptide
NP_081699.1 
UniGene
Mm.335007 
MGI
MGI:1917678 
Uniprot/SWISSPROT
P59470 
Uniprot/SPTREMBL
Q3TMK3 Q9CSL3 
Human Ortholog
ENSG00000013503 (POLR3B)
Omim not available
UniTrap UNI4488
Vector Insertion
Chr 10: 84085284 - 84090994
Public Clones AV0308 (sanger) RRJ217 (baygenomics) CMHD-GT_375D11-3 (cmhd) CMHD-GT_375E12-3 (cmhd)
IST13109F4 (tigm) IST14603A7 (tigm)
Private Clones OST197556 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3237
Vector Insertion
Chr 10: 84100918 - 84102486
Public Clones AL0542 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 18% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3821
Vector Insertion
Chr 10: 84102596 - 84109540
Public Clones AZ0771 (sanger) CMHD-GT_328D10-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5907
Vector Insertion
Chr 10: 84143210 - 84146921
Public Clones CSH109 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38402
Vector Insertion
Chr 10: 84147050 - 84155541
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 61% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6885
Vector Insertion
Chr 10: 84159812 - 84162143
Public Clones BGB202 (baygenomics) W074C06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9634
Vector Insertion
Chr 10: 84162287 - 84176373
Public Clones (sanger) XE414 (baygenomics) W061C01 (ggtc) IST14837H11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4418
Vector Insertion
Chr 10: 84176478 - 84176989
Public Clones AD0461 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 83% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38084
Vector Insertion
Chr 10: 84177157 - 84181154
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077175
Sequence
CTGCCGACTTCTTCCTCTACCGTGAATGGAATGGATGTTCTAGCCGAGGAGTTCGGGAGCCTGACTCCGGAGCAGCTGACTGCGCCGATCCCGACTGTGG

AG - UNI4488 - GAAAAATGGAGGCTGCTTCCAGCATTTTTAAAG GTTAAAGGCCTGGTGAAACAGCACATAGACTCCTTTAACTATTTCATTAAT

GTAGAG ATAAAGAAGATAATGAAAGCCAATGAAAAGGTTACAAGTGATGCTGACCCCATGTGGTACTTAAA ATACCTTAATATCTATGTCGGACTTCC

TGATGTTGAAGAAAGCTTCAATGTAACTAGACCAGTGTCCCCTCATGAG TGCCGTCTGAGGGACATGACGTACTCCGCCCCAATCACAGTGGACATTGA

GTATACCCGAGGCAGCCAGAGGATAATCCGCAACGCCTTACCCATTGGCAG AATGCCCATCATGCTCCGAAGCTCGAACTGTGTTCTAACAGGGAAAAC

GCCGGCAGAGTTTGCCAAACTGAATGAGTGTCCACTAGACCCAG GTGGCTACTTCATTGTTAAAGGAGTGGAAAAAGTCATTCTTATCCAAGAGCAGCT

GTCCAAGAACAGGATCATTGTGGAGGCCGACAGGAAAGGAGCCGTTGGAGCCTCAGTTACCAG - UNI3237 - CTCCACCCATGAGAAGAAAAGCAG

AACCAACATGGCCGTGAAACAGGGTCGATTCTATCTGAGGCACAACACCCTGTCTGAAGATATCCCCATTGTCATCATATTTAAG - UNI3821 - GC

CATGGGTGTGGAGAGTGACCAGGAAATCGTGCAGATGATTGGAACAGAGGAGCACGTGATGGCTGCATTTGGGCCCAGCTTGGAGGAGTGCCAGAAAGCT

CAGATCTTCACCCAGATGCAG GCATTGAAGTATATAGGGAATAAAGTAAGAAGACAAAGAATGTGGGGAGGTGGACCAAAGAAAACCAAAATAGAAGAA

GCAAGAGAACTCCTGGCTTCTACCATTCTGACCCACGTACCA GTGAAGGAATTCAATTTCCGAGCTAAGTGTATCTACACTGCAGTGATGGTGCGAAGG

GTGATCCTGGCCCAAGGAGATAACAAGGTCGATGACAGAGACTATTATGGCAACAAACGACTGGAATTGGCAGGACAG CTCTTATCTCTTCTTTTTGAA

GATTTGTTTAAAAAGTTTAATTCAGAAATGAAGAAGATTGCAGACCAAGTGATTCCTAAACAGAGAGCAGCCCAGTTTGACGTCGTTAAACACATGCGCC

AAGACCAGATTACCAACGGCATGGTCAATGCCATCTCCACG GGAAATTGGTCTCTGAAGAGATTTAAGATGGACCGACAGGGTGTGACCCAGGTGCTGT

CTCGCTTGTCATATATATCTGCACTCGGCATGATGACAAGAATCTCTTCCCAGTTTGAAAAGACGAGGAAAGTGAGTGGCCCTCGTTCTCTGCAGCCGTC

TCAGTGGGGAATGCTCTGTCCCTCCGACACACCTGAAGGGGAG GCCTGTGGTTTGGTTAAGAACTTGGCCCTCATGACACATATAACAACTGACATGGA

AGATGGACCCATTATTAAGTTAGCTGGGAACTTGGGAGTAGAAGATGTGAATTTATTATGTGGAGAAGAGCTCTCTTACCCAAATGTGTTTCTTGTCTTC

CTGAATG GTAACATCCTTGGTGTCATTCGAGACCATAAAAAGCTTGTCAGCACATTCCGGCTGATGCGAAGAGCAGGCTATATCAATGAATTTGTTTCT

ATCTCCACAAACCTTACGGATCGCTGTGTTTATATTTCCTCTGATGGCGGGCGCTTGTGCAG GCCTTACATAATTGTTAAGAAACAAAAGCCAGCTGTC

ACAAATAAGCACATGGAAGAGTTGGCTCAAGGCTACAG GAATTTTGAAGATTTCTTACATGAAAGTCTAGTTGAATACTTAGATGTGAATGAAGAAAAT

GACTGTAACATTGCGCTCTACGAACATACAATTAATAA - UNI5907 - AGACACCACCCACTTGGAGATTGAACCCTTCACTCTGCTTGGTGTTTGT

GCCGGCCTGATCCCATACCCTCATCACAACCAGTCTCCAAGAAACACCTACCAGTGTGCTATGGGCAAGCAAGCCATGG GTACCATTGGCTACAATCAA

CGGAACAGAATTGATACACTTATGTATCTACTAGCATATCCACAAAAGCCCATGGTTAAAACAAAAACAATCGAGTTGATAGATTTTGAGAAGTTGCCGG

CTGGCCAGAACGCAACTGTTGCCGTGATGAGCTACAGCGGCTATGACATTGAGGACGCGCTGGTTTTGAACAAGGCCTCTCTGGACAGAG GTTTTGGGC

GTTGTCTTGTGTATAAAAATGCTAAGTGCACCTTGAAACGATACACCAATCAGACCTTTGATAAGGTGATGGGTCCCATGTTGGATGCTGCTACCAGAAA

ACCCATCTGGCGACATGAAATTTTAGATGCAGATGGCATTTGTTCTCCAG GTGAGAAAGTGGAAAACAAACAGGTGCTTGTAAACAAGTCCATGCCCAC

AGTGACACAGATTCCTTTGGAAGGGAGCAACGTGCCACAGCAACCACAGTATAAAGATGTGCCTATCAC - UNI6885 - GTACAAAGGTGCGACAGA

CTCCTACATCGAGAAAGTGATGATCTCTTCCAACGCCGAGGATGCTTTCCTCATCAAGATGCTCCTGAGACAGACGCGGCGCCCAGAGATTGGAGACAAA

TTCAGCAGTCGCCATGGACAAAAGG - UNI9634 - GTGTCTGTGGCCTGATCGTCCCCCAGGAAGACATGCCGTTCTGTGATTCTGGCATCTGTCCC

GACATCATAATGAACCCACACGGCTTCCCATCAAGAATGACG - UNI4418 - GTTGGAAAGTTAATTGAGCTGCTGGCTGGCAAGGCAGGCGTGTTA

GACGGCAGGTTCCACTACGGCACTGCCTTTGGAGGGAGTAAAGTGAAGGATGTGTGTGAAGATCTCGTTCGCCATGGTTACAACTACCTGGGGAAGGACT

ACGTCACCTCAGGCATCACAGG TGAGCCCTTAGAAGCATACATCTATTTTGGACCTGTGTATTATCAGAAACTGAAACACATGGTGCTGGATAAAATGC

ACGCCCGGGCCCGAGGACCACGAGCTGTCCTTACCAG GCAGCCCACTGAAGGGCGGTCGCGCGATGGTGGCTTGCGACTTGGAGAAATGGAACGCGACT

GTCTAATCGGCTATGGAGCGAGTATGCTTTTGCTGGAGAGACTAATGATCTCAAGTGATGCCTTTGAGGTTGACGTCTGCGGGCAGTGTGGACTCCTGGG

ATATTCTGGCTG GTGCCACTACTGCAAATCTTCGTGCCACGTGTCCTCCCTCCGCATCCCGTATGCCTGCAAGCTGCTCTTCCAGGAGTTACAGTCCAT

GAACATCATCCCCAGGCTGAAACTGGCCAAGTACAACGAGTAAGGCTGTGCGGTGCTCACGAGGGTGCAGTCGGCCGACGGCCTGTACAGCCTGAGGCAG

GGGGCTCTCGGTGACTTCTGTGCTCATTCTGCTTCACGGAGGAGGCAGAGGAGGAGGAGGAAGAAGAGGAAGAAGGAGAGGAGGAGGAAGAGAATGAAGG

AGAGGAGGAAGAGGAGCAGCAGCAGCAGCTGTCTGAGGTCCAGAGGCTGGCTTGACACCCTTGATCTGGAGCCTGAAGCCATAGGAGGTGCTGGGCCCCG

CACAGCACTGAGTGGAGTCACACACAGATGGACACAAGCTAGAGAGAGTACCAACGCCTATTAATTTTGTTGTTTGTTTGTTTGTGTTGAGTGGGAGTCT

CACTCTATCCCAGGTGGGATTTGAACTCACCTCAATTCTCCTGCCTTTGTCTCCCACAAGTGCTGGAATCATGGATATGAGCCAAGCATATCTGGTTTGT

TTATGTTATTATGTTTTAAACTGTACTTGTTAGAAAAACCTTCTTCCTTTAAATTTCCTCTGAGGTCTTCTAGCTAACAGAATCCTGGGTTCTCATCAGA

TGTGGAGGAGGTAAAGAATTGTTTGAATTGGGACTGAGAAGTTAGCTCAGTCAAGGGCCTGTTGCATAAGTATGACCTGAGTTCACCCCCCAACAACCCA

TGTAAGGGCTGGGTGTGGCACCTAGCACCCCTGTAAAAGTCAGATACTGAGGGGGTGGGGGTGGGGAGCAGACAGACTGACCCCTGGCGCTTTCTGACCA

GCTGGCATAACCAGTCAGTGCAATTCAGGTTCAATGAGGGACCCCTGTGTCAAGGGCTAGTGTGAACAGTGACTGAGGAGGACCCCAGTGTCCCTCTGGC

CTCCACACACACATCCAAAGAATGGGTAGATGTGTGGGCACAACTTTTGCTGAGGTGGGAAGAAGTAAACTTTCTCTCAGAGGACAGCAAGTGACATTTG

TGACTCTGAAAGACCAGCAGTCACAGTCTGCTGTCACATTGTGAGTCAGAGCTTGCTCAGACATCGATCTTGATGGAATGTGATCTGTGAAGTCTACCTT

TTAAGACTCTCCTCCTACTTCTTTTGAACCTGCAGGATACCTAGGTCTAATCCATGGGCCCCTGGTCACTCATTTCCTACCTTTCCATTGCTACCAGAAA

GTTAGCTGTCCACTCTCTCAGTTTGTTCTTAACTGTTGTGCCCTGGCTCCAGATAAATGTTTATATGGAGAAGTGTTCAGAGAGAGAGTGTGCCCCAGCA

GCATTGAGTGTGCGGATGAGGCTGAGGAGGGAGTGCGAGGACTTTGCAGATCTCACTCCAGGCTCATCCGGATGAGTCACGACTTAAAGACTCAACCCTG

TTTGTTTTCTTCACAATAAAGATGTGGCAGTCAGAACGGT
Translation
MDVLAEEFGSLTPEQLTAPIPTVE - UNI4488 - EKWRLLPAFLK VKGLVKQHIDSFNYFINVE IKKIMKANEKVTSDADPMWYLK KYLNIYVG

LPDVEESFNVTRPVSPHE CRLRDMTYSAPITVDIEYTRGSQRIIRNALPIGR RMPIMLRSSNCVLTGKTPAEFAKLNECPLDPG GGYFIVKGVEKVI

LIQEQLSKNRIIVEADRKGAVGASVTS - UNI3237 - SSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIFK - UNI3821 - AMGVESDQEI

VQMIGTEEHVMAAFGPSLEECQKAQIFTQMQ ALKYIGNKVRRQRMWGGGPKKTKIEEARELLASTILTHVP VKEFNFRAKCIYTAVMVRRVILAQGDN

KVDDRDYYGNKRLELAGQ LLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIST GNWSLKRFKMDRQGVTQVLSRLSYIS

ALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLCPSDTPEGE ACGLVKNLALMTHITTDMEDGPIIKLAGNLGVEDVNLLCGEELSYPNVFLVFLNG GN

ILGVIRDHKKLVSTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCR RPYIIVKKQKPAVTNKHMEELAQGYR RNFEDFLHESLVEYLDVNEEND

CNIALYEHTINK - UNI5907 - KDTTHLEIEPFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMG GTIGYNQRNRIDTLMYLLAYPQKPMVKTKT

IELIDFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRG GFGRCLVYKNAKCTLKRYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPG GEK

VENKQVLVNKSMPTVTQIPLEGSNVPQQPQYKDVPIT - UNI6885 - TYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKG 

- UNI9634 - GVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMT - UNI4418 - VGKLIELLAGKAGVLDGRFHYGTAFGGSKVKDVCEDLVRH

GYNYLGKDYVTSGITG GEPLEAYIYFGPVYYQKLKHMVLDKMHARARGPRAVLTR RQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAF

EVDVCGQCGLLGYSGW WCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLAKYNE

For any suggestions or comments, please send an email to unitrap@crg.es