Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034485 (Uaca)
Chromosomal location
Chr 9: 60642355 - 60728177 (+)
Description
uveal autoantigen with coiled-coil domains and ankyrin repeats Gene [Source:MGI Symbol;Acc:MGI:1919815]
RefSeq_dna
NM_028283 
RefSeq_peptide
NP_082559.1 
UniGene
Mm.68819 
MGI
MGI:1919815 
Uniprot/SWISSPROT
Q8CGB3 
Uniprot/SPTREMBL
Q8CIA8 
Human Ortholog
ENSG00000137831 (UACA)
Omim not available
UniTrap UNI8152
Vector Insertion
Chr 9: 60642500 - 60688646
Public Clones RRH013 (baygenomics) IST14450G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36135
Vector Insertion
Chr 9: 60708967 - 60711197
Public Clones IST12579A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28305
Vector Insertion
Chr 9: 60714209 - 60715238
Public Clones not available
Private Clones OST34460 (lexicon)
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4817
Vector Insertion
Chr 9: 60724235 - 60727980
Public Clones AN0304 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000058974
Sequence
CCGGCTCTTGCCCTCGCAGCCCGCAATCTGGTGGGAACCCGGACCCTTGAGAGCCGTGGCCATGAAGAGCCTCAAGTCCCGACTGTGGAAGCAGGACGCG

CCCGGCCCCACGTCACCCTCATCGCCCACCGCGGTGGCCAGCACG - UNI8152 - CAATCAGCGGAGTGGAATAAGTACGATGACCGGTTGATGAAG

GCTGCTGAAAGAGGGGATGTGGAGAAAGTGTCCTCCATCCTTGCCAAAAAGGGCGTCCATCCCGGCAAGCTAGATGTGGAAGGCAGATCGGC CTTCCAC

GTCGTGGCATCCAAAGGGAATCTGGAGTGTCTGAATGCCATCCTTACGCATGGCATTGATGTTGCAACCAGGGACAGTGCAG GGAGGAATGCGCTTCAC

CTGGCAGCTAAGTACGGACACGCGTTGTGCCTGCAGAAACTTCTACAG TACAACTGTCCCACTGAGCATGTGGACCTTCAAGGAAGAACTGCCCTTCAT

GATGCAG CCATGGCAGACTGTCCTTCCAGCATCCAGCTGCTCTGTGACCACGGGGCCTCCGTGAATGCCAAAGATATA GACGGGCGGACACCACTTGT

TCTGGCGACTCAGATGTGCAGGCCGACAATTTGTCAGTTGCTGATAGACAGAGGGGCAGATGTCAATTCCAGAGACAAACAAAACAG GACAGCTCTGAT

GCTGGGCTGCGAGTACGGTTGCAGAGATGCCGTAGAAGTCCTCGTGAAAAATGGTGCCGACCTGACCTTGCTGGATGCCCTTGGCCACGACAGTTCTTAC

TACGCTAGAATTGGTGACAACCTGGACATCCTGAACCTACTGAAGACGGCGTCAGAAAACACCAACAAAG GGCGAGAACTTTGGAGGAAAGGACCGCCT

TTGCAGCAG CGGAATTTGTCACACACTCAGGACGAAGGAAGCGTGAAGTCAACTCAGAGGGAACAGAGGGAACCCCACAGCTTTCAG GATCTAGAGAT

TGAAAATGAAGATTTAAGAGAGAAGTTGAGGAAGATTCAGCAAGAACAAAGAATCCTCCTGGATAAAGTCAATGGCTTACAGTTACAGCTGAATGAG - 

UNI36135 - GAAGTAATGGTCGCAGATGATCTGGAAAGCGAG AGAGAAAAGCTGAAGTCCCTTTTGGCGGCTAAAGAAAAGCAACACGAAGAAAGCT

TAAGAACCATCGAGGCCCTGAAAAACAGATTTAAATATTTTGAG AGTGATCACCCAGGACCCGGAAGTTACCCGAGTAACC - UNI28305 - GAAA

AGAAGACATGCTGCATAAACAAGGTCAAATGTACACGACAGAGCCACAG TGTGCATCACCGGGTATACCTCCCCATATGCATAGCAGGTCTATGCTAAG

GCCTCTGGAGTTGTCTTTACCCAGTCAGACCTCATACTCTGAAAATGAGATTTTAAAGAAAGAATTGGAAACCTTGCGAACTTACTATGACTCGGCAAAA

CAGGACCGACTGAAGTTCCAAAACGAACTGGCTCACAAGGTGGCGGAGTGCAAAGCCTTAGCTCTGGAGTGCGAGAGAGTCAAGGAAGACTCGGACGAAC

AGATCAAGCAGCTGGAAGATGCCCTCAAAGACGTGCAGAAGAGGATGTATGAGTCCGAAGGGAAAGTCAAACAAATGCAGACCCACTTCCTCGCCCTCAA

AGAGCACCTGACCAACGAAGCGGCCACAGGGAGCCACCGCATCATCGAGGAACTGAGGGAGCAGCTGAAAGACCTGAAAGGCAAATATGAAGGCGCTTCG

GCCGAG GTGCACAGCCTCACGGTGGAGATGAAAACGCGCTACGTGCCTCTAAGGGTCAGCGAAGAGATGAAGAAGTCGCATGACGTAAACGTGGAGGAT

TTGAATAAGAAGCTTTCGGAGGCAACACAGAGATACACAGAGAAGAAGCAGGAAGCAGAGAGACTGCTGGCGGAGAACGATAAGTTGACTAAGAATGTCA

GCCGCCTGGAAGCTGTGTTTGTAGCTCCCGAGAAACATGAAAAGGAGCTAATGGGTCTGAAATCCAATATCGCAGAACTGAAAAAGCAACTGTCTGAGCT

TAATAAAAAATGTGGTGAGGGTCAGGAGAAAATACGTGCACTTATGTCTGAAAACAGCAGCTTGAAAAAGACTCTGAGTAGCCAGTATGTGCCTGCCAAG

ACCCACGAGGAGGTGAAGGCCTCCCTGAACAGCACCGTGGAGAAAACCAACAGAGCCTTACTGGAGGCGAAGAAAAGGTTTGACGACACGAGCCAGGAGG

TTTCAAAACTAAGAGATGAGAACGAAGTATTGAGGAGGAACCTGGAGAACGTTCAGAATCAGATGAAGGCTGACTATGTGAGCCTGGAGGAGCACTCGAG

AAGGATGAGCACGGTGAGCCAGAGTCTGAAGGAGGCACAGGAGGCCAACGCTGCCATCCTGGCCGACCACCGCCAGGGCCAGGAGGAGATCGTCTCGCTC

CACGCTGAAATCAAGGCCCAGAAAAAGGAGCTGGACACCATCCAGGAGTGCATCAAGCTGAAGTACGCGCCCCTTGCCCGCTTGGAAGAGTGTGAGCGCA

AGTTCAAGGCCACAGAGAAAGGACTGAAGGAGCAGTTATCAGAGCAGACGCACAAGTGTCGCCAGAGGGACGAAGAGGTCAAGAAGGGCAAGCAAGAGAA

CGAGAGGCTGCGGGCGGACCTGGCCGCCCTTCAGAAGGAGCTGCAGGATAGGAACGCTCTGGCGGAAGAGGCCCGGGAAGCAGAAAGAGCGTTGAGTGGC

AAGGCAGACGAGCTCAGCAAGCAGCTGAAGGACCTGTCCCAAAAGTACAGCGACGTGAAGAGCGAGAGAGAGAAGCTGGTAGAAGAAAAGGCCAAGCAGG

CCTCCGAGATCCTGGCAGCCCAAAATCTTCTGCAGAAGCAGCCGGTCCCGCTGGAGCAGGTGGAGGCTCTGAAAAAATCTCTCAACGGCACCATTGAGCA

GTTGAAGGAGGAGCTGAGGAGTAAGCAGAGGTGTCTGGAGCGCGAGCAGCAGACGGTGAGCCAGCTTCAGCAGCTGCTGGAGAATCAGAAGAACTCCTCG

GTGACCCTGGCGGAGCACCTGAAGCTAAAGGAAGCCCTCGAGAAAGAGGTTGGGATCATGAAAGCCAGCCTGAGAGAAAAGGAAGAGGAAAGCCAGAAGA

AAACCAAGGAAGTCTCCAAACTCCAGACGGAGGTTCAGACCACCAAGCAGGCGCTGAAGAACTTAGAGACCAGAGAGGTCGTCGACATGTCGAAGTACAA

AGCCACCAAGAACGACTTGGAGACCCAGATTTCCAACTTAAATGACAAACTGGCCAGCCTGAACAGGAAGTACGACCAAGCGTGTGAGGAGAAGGTCTCT

GCCAAGGACGAGAAGGAGCTGCTCCACCTGAGCATCGAGCAGGAGATCAGGGACCAGAAGGAGCGCTGTGACAAGTCCCTGACGACCATCATGGAACTGC

AGCAGAGGATCCAGGAGTCCGCCAAGCAGATCGAAGCCAAGGACAATAAG ATAACTGAACTTCTGAATGATGTCGAAAGACTAAAGCAGGCGCTCAACG

GCCTTTCTCAGCTCACCTACAGCAGTGGCAGCCCCACCAAGCGGCAGAGCCAGCTGGTGGATACTCTGCAGCAGCGAGTGAGGGATCTGCAGCAGCAGCT

GGCT GATGCTGACAGACAGCACCAAGAAGTTATCGCTATCTACCGGACACACCTCCTCAGTGCCGCACAG - UNI4817 - GGCCACATGGATGAAG

ATGTGCAGGCAGCCCTACTGCAGATCATACAGATGCGACAAGGCCTTGTGTGCTAGCGGCAGCTGACTTGGAGCCTGTCCTGCTGGTGCTATGCATTCTG

GGTGCAACTCTGTGCTCTTCTGGGCCTTACTCTGATAGTATCAGTAAAATAAACTATATTTTGTTCCGTTGTTGAATTTTA
Translation
 - UNI8152 - MKAAERGDVEKVSSILAKKGVHPGKLDVEGRSA AFHVVASKGNLECLNAILTHGIDVATRDSAG GRNALHLAAKYGHALCLQKLL

Q YNCPTEHVDLQGRTALHDAA AMADCPSSIQLLCDHGASVNAKDI DGRTPLVLATQMCRPTICQLLIDRGADVNSRDKQNR RTALMLGCEYGCRDA

VEVLVKNGADLTLLDALGHDSSYYARIGDNLDILNLLKTASENTNKG GRELWRKGPPLQQ RNLSHTQDEGSVKSTQREQREPHSFQ DLEIENEDLRE

KLRKIQQEQRILLDKVNGLQLQLNE - UNI36135 - EVMVADDLESE REKLKSLLAAKEKQHEESLRTIEALKNRFKYFE SDHPGPGSYPSNR -

 UNI28305 - RKEDMLHKQGQMYTTEPQ CASPGIPPHMHSRSMLRPLELSLPSQTSYSENEILKKELETLRTYYDSAKQDRLKFQNELAHKVAECKA

LALECERVKEDSDEQIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTNEAATGSHRIIEELREQLKDLKGKYEGASAE VHSLTVEMKTRYVPLR

VSEEMKKSHDVNVEDLNKKLSEATQRYTEKKQEAERLLAENDKLTKNVSRLEAVFVAPEKHEKELMGLKSNIAELKKQLSELNKKCGEGQEKIRALMSEN

SSLKKTLSSQYVPAKTHEEVKASLNSTVEKTNRALLEAKKRFDDTSQEVSKLRDENEVLRRNLENVQNQMKADYVSLEEHSRRMSTVSQSLKEAQEANAA

ILADHRQGQEEIVSLHAEIKAQKKELDTIQECIKLKYAPLARLEECERKFKATEKGLKEQLSEQTHKCRQRDEEVKKGKQENERLRADLAALQKELQDRN

ALAEEAREAERALSGKADELSKQLKDLSQKYSDVKSEREKLVEEKAKQASEILAAQNLLQKQPVPLEQVEALKKSLNGTIEQLKEELRSKQRCLEREQQT

VSQLQQLLENQKNSSVTLAEHLKLKEALEKEVGIMKASLREKEEESQKKTKEVSKLQTEVQTTKQALKNLETREVVDMSKYKATKNDLETQISNLNDKLA

SLNRKYDQACEEKVSAKDEKELLHLSIEQEIRDQKERCDKSLTTIMELQQRIQESAKQIEAKDNK ITELLNDVERLKQALNGLSQLTYSSGSPTKRQSQ

LVDTLQQRVRDLQQQLA DADRQHQEVIAIYRTHLLSAAQ - UNI4817 - GHMDEDVQAALLQIIQMRQGLVC
Transcript ENSMUST00000050183
Sequence
CCGGCTCTTGCCCTCGCAGCCCGCAATCTGGTGGGAACCCGGACCCTTGAGAGCCGTGGCCATGAAGAGCCTCAAGTCCCGACTGTGGAAGCAGGACGCG

CCCGGCCCCACGTCACCCTCATCGCCCACCGCGGTGGCCAGCACG - UNI8152 - CAATCAGCGGAGTGGAATAAGTACGATGACCGGTTGATGAAG

GCTGCTGAAAGAGGGGATGTGGAGAAAGTGTCCTCCATCCTTGCCAAAAAGGGCGTCCATCCCGGCAAGCTAGATGTGGAAGGCAGATCGGC CTTCCAC

GTCGTGGCATCCAAAGGGAATCTGGAGTGTCTGAATGCCATCCTTACGCATGGCATTGATGTTGCAACCAGGGACAGTGCAG GGAGGAATGCGCTTCAC

CTGGCAGCTAAGTACGGACACGCGTTGTGCCTGCAGAAACTTCTACAG TACAACTGTCCCACTGAGCATGTGGACCTTCAAGGAAGAACTGCCCTTCAT

GATGCAG CCATGGCAGACTGTCCTTCCAGCATCCAGCTGCTCTGTGACCACGGGGCCTCCGTGAATGCCAAAGATATA GACGGGCGGACACCACTTGT

TCTGGCGACTCAGATGTGCAGGCCGACAATTTGTCAGTTGCTGATAGACAGAGGGGCAGATGTCAATTCCAGAGACAAACAAAACAG GACAGCTCTGAT

GCTGGGCTGCGAGTACGGTTGCAGAGATGCCGTAGAAGTCCTCGTGAAAAATGGTGCCGACCTGACCTTGCTGGATGCCCTTGGCCACGACAGTTCTTAC

TACGCTAGAATTGGTGACAACCTGGACATCCTGAACCTACTGAAGACGGCGTCAGAAAACACCAACAAAGGTGGCG GGCGAGAACTTTGGAGGAAAGGA

CCGCCTTTGCAGCAG CGGAATTTGTCACACACTCAGGACGAAGGAAGCGTGAAGTCAACTCAGAGGGAACAGAGGGAACCCCACAGCTTTCAG GATCT

AGAGATTGAAAATGAAGATTTAAGAGAGAAGTTGAGGAAGATTCAGCAAGAACAAAGAATCCTCCTGGATAAAGTCAATGGCTTACAGTTACAGCTGAAT

GAG - UNI36135 - GAAGTAATGGTCGCAGATGATCTGGAAAGCGAG AGAGAAAAGCTGAAGTCCCTTTTGGCGGCTAAAGAAAAGCAACACGAAG

AAAGCTTAAGAACCATCGAGGCCCTGAAAAACAGATTTAAATATTTTGAG AGTGATCACCCAGGACCCGGAAGTTACCCGAGTAACC - UNI28305 

- GAAAAGAAGACATGCTGCATAAACAAGGTCAAATGTACACGACAGAGCCACAG TGTGCATCACCGGGTATACCTCCCCATATGCATAGCAGGTCTAT

GCTAAGGCCTCTGGAGTTGTCTTTACCCAGTCAGACCTCATACTCTGAAAATGAGATTTTAAAGAAAGAATTGGAAACCTTGCGAACTTACTATGACTCG

GCAAAACAGGACCGACTGAAGTTCCAAAACGAACTGGCTCACAAGGTGGCGGAGTGCAAAGCCTTAGCTCTGGAGTGCGAGAGAGTCAAGGAAGACTCGG

ACGAACAGATCAAGCAGCTGGAAGATGCCCTCAAAGACGTGCAGAAGAGGATGTATGAGTCCGAAGGGAAAGTCAAACAAATGCAGACCCACTTCCTCGC

CCTCAAAGAGCACCTGACCAACGAAGCGGCCACAGGGAGCCACCGCATCATCGAGGAACTGAGGGAGCAGCTGAAAGACCTGAAAGGCAAATATGAAGGC

GCTTCGGCCGAGGTAGGCAAGCTGCGGAGCCAGATCAAACAGAGCGAGATGCTGGTGGGAGAGTTCAAGAGAGACGAGGGCAGGCTGGTGGAAGAGAATA

AGCGATTGCAGAAGGAATGCGGCACATGTGAAGTCGAGCTGGAGAGGAGGGGGCGACGGGTCGTGGAACTGGAGGGCCAGCTGAAGGAGCTGGGGGCTAA

GCTGGCCCTTTCTGTCCCCACAGAGAAATTTGAAAGCATGAAGAGCTCATTATCCAATGACATCAATGAGAAAGTGAAAAGGCTGGCGGAGGTGGGGCGG

GACTATGAAAGCGCTCAGGGGGAAATTCGACAGCTGAAGAGGGACCTAGAGAGTGTCAGGGCCCAGCATATCAGGCCGGAGGAGCATGAACAGCTCAGAA

GCAGGTTGGAGCAGAAGTCGGGAGAGCTGGGGAAGAAGGTGTCAGAGCTGACCCTCAAAAACCAGACGCTGCAGAAAGACGTGGAAAAACTCCACGCCGA

CAACAAACTTCTCAACCAGCAGGTGCACAGCCTCACGGTGGAGATGAAAACGCGCTACGTGCCTCTAAGGGTCAGCGAAGAGATGAAGAAGTCGCATGAC

GTAAACGTGGAGGATTTGAATAAGAAGCTTTCGGAGGCAACACAGAGATACACAGAGAAGAAGCAGGAAGCAGAGAGACTGCTGGCGGAGAACGATAAGT

TGACTAAGAATGTCAGCCGCCTGGAAGCTGTGTTTGTAGCTCCCGAGAAACATGAAAAGGAGCTAATGGGTCTGAAATCCAATATCGCAGAACTGAAAAA

GCAACTGTCTGAGCTTAATAAAAAATGTGGTGAGGGTCAGGAGAAAATACGTGCACTTATGTCTGAAAACAGCAGCTTGAAAAAGACTCTGAGTAGCCAG

TATGTGCCTGCCAAGACCCACGAGGAGGTGAAGGCCTCCCTGAACAGCACCGTGGAGAAAACCAACAGAGCCTTACTGGAGGCGAAGAAAAGGTTTGACG

ACACGAGCCAGGAGGTTTCAAAACTAAGAGATGAGAACGAAGTATTGAGGAGGAACCTGGAGAACGTTCAGAATCAGATGAAGGCTGACTATGTGAGCCT

GGAGGAGCACTCGAGAAGGATGAGCACGGTGAGCCAGAGTCTGAAGGAGGCACAGGAGGCCAACGCTGCCATCCTGGCCGACCACCGCCAGGGCCAGGAG

GAGATCGTCTCGCTCCACGCTGAAATCAAGGCCCAGAAAAAGGAGCTGGACACCATCCAGGAGTGCATCAAGCTGAAGTACGCGCCCCTTGCCCGCTTGG

AAGAGTGTGAGCGCAAGTTCAAGGCCACAGAGAAAGGACTGAAGGAGCAGTTATCAGAGCAGACGCACAAGTGTCGCCAGAGGGACGAAGAGGTCAAGAA

GGGCAAGCAAGAGAACGAGAGGCTGCGGGCGGACCTGGCCGCCCTTCAGAAGGAGCTGCAGGATAGGAACGCTCTGGCGGAAGAGGCCCGGGAAGCAGAA

AGAGCGTTGAGTGGCAAGGCAGACGAGCTCAGCAAGCAGCTGAAGGACCTGTCCCAAAAGTACAGCGACGTGAAGAGCGAGAGAGAGAAGCTGGTAGAAG

AAAAGGCCAAGCAGGCCTCCGAGATCCTGGCAGCCCAAAATCTTCTGCAGAAGCAGCCGGTCCCGCTGGAGCAGGTGGAGGCTCTGAAAAAATCTCTCAA

CGGCACCATTGAGCAGTTGAAGGAGGAGCTGAGGAGTAAGCAGAGGTGTCTGGAGCGCGAGCAGCAGACGGTGAGCCAGCTTCAGCAGCTGCTGGAGAAT

CAGAAGAACTCCTCGGTGACCCTGGCGGAGCACCTGAAGCTAAAGGAAGCCCTCGAGAAAGAGGTTGGGATCATGAAAGCCAGCCTGAGAGAAAAGGAAG

AGGAAAGCCAGAAGAAAACCAAGGAAGTCTCCAAACTCCAGACGGAGGTTCAGACCACCAAGCAGGCGCTGAAGAACTTAGAGACCAGAGAGGTCGTCGA

CATGTCGAAGTACAAAGCCACCAAGAACGACTTGGAGACCCAGATTTCCAACTTAAATGACAAACTGGCCAGCCTGAACAGGAAGTACGACCAAGCGTGT

GAGGAGAAGGTCTCTGCCAAGGACGAGAAGGAGCTGCTCCACCTGAGCATCGAGCAGGAGATCAGGGACCAGAAGGAGCGCTGTGACAAGTCCCTGACGA

CCATCATGGAACTGCAGCAGAGGATCCAGGAGTCCGCCAAGCAGATCGAAGCCAAGGACAATAAG ATAACTGAACTTCTGAATGATGTCGAAAGACTAA

AGCAGGCGCTCAACGGCCTTTCTCAGCTCACCTACAGCAGTGGCAGCCCCACCAAGCGGCAGAGCCAGCTGGTGGATACTCTGCAGCAGCGAGTGAGGGA

TCTGCAGCAGCAGCTGGCT GATGCTGACAGACAGCACCAAGAAGTTATCGCTATCTACCGGACACACCTCCTCAGTGCCGCACAG - UNI4817 - G

GCCACATGGATGAAGATGTGCAGGCAGCCCTACTGCAGATCATACAGATGCGACAAGGCCTTGTGTGCTAGCGGCAGCTGACTTGGAGCCTGTCCTGCTG

GTGCTATGCATTCTGGGTGCAACTCTGTGCTCTTCTGGGCCTTACTCTGATAGTATCAGTAAAATAAACTATATTTTGTTCCGTTGTTGAATTTTA
Translation
MKSLKSRLWKQDAPGPTSPSSPTAVAST - UNI8152 - QSAEWNKYDDRLMKAAERGDVEKVSSILAKKGVHPGKLDVEGRSA AFHVVASKGNLEC

LNAILTHGIDVATRDSAG GRNALHLAAKYGHALCLQKLLQ YNCPTEHVDLQGRTALHDAA AMADCPSSIQLLCDHGASVNAKDI DGRTPLVLATQM

CRPTICQLLIDRGADVNSRDKQNR RTALMLGCEYGCRDAVEVLVKNGADLTLLDALGHDSSYYARIGDNLDILNLLKTASENTNKGGG GRELWRKGPP

LQQ RNLSHTQDEGSVKSTQREQREPHSFQ DLEIENEDLREKLRKIQQEQRILLDKVNGLQLQLNE - UNI36135 - EVMVADDLESE REKLKSL

LAAKEKQHEESLRTIEALKNRFKYFE SDHPGPGSYPSNR - UNI28305 - RKEDMLHKQGQMYTTEPQ CASPGIPPHMHSRSMLRPLELSLPSQT

SYSENEILKKELETLRTYYDSAKQDRLKFQNELAHKVAECKALALECERVKEDSDEQIKQLEDALKDVQKRMYESEGKVKQMQTHFLALKEHLTNEAATG

SHRIIEELREQLKDLKGKYEGASAEVGKLRSQIKQSEMLVGEFKRDEGRLVEENKRLQKECGTCEVELERRGRRVVELEGQLKELGAKLALSVPTEKFES

MKSSLSNDINEKVKRLAEVGRDYESAQGEIRQLKRDLESVRAQHIRPEEHEQLRSRLEQKSGELGKKVSELTLKNQTLQKDVEKLHADNKLLNQQVHSLT

VEMKTRYVPLRVSEEMKKSHDVNVEDLNKKLSEATQRYTEKKQEAERLLAENDKLTKNVSRLEAVFVAPEKHEKELMGLKSNIAELKKQLSELNKKCGEG

QEKIRALMSENSSLKKTLSSQYVPAKTHEEVKASLNSTVEKTNRALLEAKKRFDDTSQEVSKLRDENEVLRRNLENVQNQMKADYVSLEEHSRRMSTVSQ

SLKEAQEANAAILADHRQGQEEIVSLHAEIKAQKKELDTIQECIKLKYAPLARLEECERKFKATEKGLKEQLSEQTHKCRQRDEEVKKGKQENERLRADL

AALQKELQDRNALAEEAREAERALSGKADELSKQLKDLSQKYSDVKSEREKLVEEKAKQASEILAAQNLLQKQPVPLEQVEALKKSLNGTIEQLKEELRS

KQRCLEREQQTVSQLQQLLENQKNSSVTLAEHLKLKEALEKEVGIMKASLREKEEESQKKTKEVSKLQTEVQTTKQALKNLETREVVDMSKYKATKNDLE

TQISNLNDKLASLNRKYDQACEEKVSAKDEKELLHLSIEQEIRDQKERCDKSLTTIMELQQRIQESAKQIEAKDNK ITELLNDVERLKQALNGLSQLTY

SSGSPTKRQSQLVDTLQQRVRDLQQQLA DADRQHQEVIAIYRTHLLSAAQ - UNI4817 - GHMDEDVQAALLQIIQMRQGLVC

For any suggestions or comments, please send an email to unitrap@crg.es