Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034488 (Edil3)
Chromosomal location
Chr 13: 88961077 - 89462830 (+)
Description
EGF-like repeats and discoidin I-like domains 3 Gene [Source:MGI (curated);Acc:Edil3-001]
Human Ortholog
not available
Omim not available
UniTrap UNI38627
Vector Insertion
Chr 13: 89271461 - 89316749
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35231
Vector Insertion
Chr 13: 89429180 - 89459275
Public Clones IST11130B4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000118731
Sequence
AGCTAGGCTCAGTCTCACACGCGCGCCGCCACTGTTTGTACACAGTGCGCTCCTGGCCTCAGGCTCGCTCCCCTCCAGCTCTCGCTTCATTGTTCTCCAA

GTCAGAAGCCCCCGCAGCCGCCGCGGCAGCAGCGTGAGCCGTAGTCACTGCTGGCCGCTTCGCCTGCGGTGCGCGCACGGAAATCGGGGAGCCAGGAACC

CAAGGAGCCCGCGCTCCGCCCGCTGTGCCTCTGCTAGGACCCACTCGCAGCCCCAGCCTCTCTCAAGCGCACCCACCTCCGCGCACCCCAGCTCAGGCGA

AGCTGGAGTGAGGGGTGAATCACCCTTTCTCTAGGGCCACCACTCTTTTATCGCCCTTCCCAAGAATTTGAGGAAGCGCTGCGGGAGGAAAGACGTCCTC

TTGAATCTCTGACAGGGCGGGGTTTACTGCTGTCCTGCAGGGCCGCCTCGCCTACTGTGCCCTCCGCTACGACCCCGGACCAGCCCAGGTCACGTCCGTG

AGAAGGGATCATGAAGCACTTGGTAGCAGCCTGGCTTTTGGTTGGACTCAGCCTCGGGGTGCCCCAGTTCGGCAAAG GTGACATTTGCAACCCGAACCC

CTGTGAAAATGGTGGCATCTGTCTGTCAGGACTGGCTGATGATTCCTTTTCCTGTGAGTGTCCAGAAGGCTTCGCAGGTCCGAACTGCTCTAGTGTTGTG

GAGGTTG CATCAGATGAAGAAAAGCCTACTTCAGCAG GTCCCTGCATCCCTAACCCATGCCATAACGGAGGAACCTGTGAGATAAGCGAAGCCTATCG

AGGAGACACATTCATAGGCTATGTTTGTAAATGTCCTCGGGGATTTAATGGGATTCACTGTCAGCACA ATATAAATGAATGTGAAGCTGAGCCTTGCAG

AAATGGCGGAATATGTACCGACCTTGTTGCTAACTACTCTTGTGAATGCCCAGGAGAATTTATGGGACGAAATTGTCAATATA AATGCTCTGGGCCATT

GGGAATCGAAGGTGGGATCATATCTAATCAGCAAATCACAGCTTCATCTACTCACCGAGCTCTTTTTGGACTCCAGAAGTGGTATCCCTACTATGCTCGA

CTTAATAAGAAGGGCCTTATAAATGCCTGGACAGCTGCTGAAAATGACAGATGGCCATGGATTCAG ATAAATTTGCAAAGAAAAATGAGAGTCACTGGT

GTTATTACCCAAGGAGCAAAAAGGATTGGAAGCCCAGAGTACATAAAATCCTACAAAATTGCCTACAGCAATGACGGGAAGACCTGGGCAATGTACAAAG

TAAAAGGCACCAATGAAGAGATG GTCTTTCGTGGAAATGTTGATAACAACACACCATATGCTAATTCTTTCACACCCCCAATCAAAGCTCAGTATGTAA

GACTCTACCCCCAAATTTGTCGAAGGCATTGTACTTTAAGAATGGAACTTCTTGGCTGTGAGCTCTCAG GCTGTTCAGAACCTTTGGGGATGAAATCAG

GGCATATACAAGACTACCAGATCACTGCCTCCAGCGTCTTCAGAACACTCAACATGGACATGTTTACTTGGGAACCAAGGAAAGCCAGGCTGGACAAGCA

AGGCAAAGTAAATGCCTGGACTTCCGGCCATAACGACCAGTCACAATGGTTACAG CTGCCTTGTACTCTCTAATGGGATACAGAGACGTTTCTAAAAAT

AAGACAGCTCAAAGCTCTCAGTGGAGGAACGTATACCAACAGCTGCTTGTATCTTCTAACATCCTGGGTGTCAAAGGCATTTTCTCAAAGTGTGGTTAAA

GGCTGCCTTCATCTGAGTCTTCTAGCTGAATGAAACATTCTTAACTCCATTCTCTGAGATGCTCATGTGATAGGGGTTGCACATAGAAAAGTGAGTTTGG

TGACAAATATACTTAGATTCTTTATGAAAGATGAAGCTTGAAAAAATCAATTATTCCAAGGGAATTATTTTAATGAGCTTTCCATATACTTAATTAAAAA

CTACTTGGATATTAAAAGTTCAGGCTTATGTTGATTTGACATTTATTCAGTGAAAGAATTTGACAACAAAACTTTAATTATTCCTCGCACTAGACTAAAT

AAAGTCTACAAAAGATATACATTTAGAGTCCAATAAAATCAATAAGAAAGTGGATCTGTATTGGCAGTTGTAGTTGTGGTTTTCACTGGCATGCCTGTGA

TGGAATCTACATAACATTTTAAACAGACCTTTAATATATGTACACACAGACATAGACATACTGCTGAACATTCACAATGACAAACAGTCTACACAATGGT

CATGAGTATTGCCAAAAATTAAGAAGGCCTAGGATGAAGTACATATTTTTACACTGAAAATTTGTTAAATAAGACTGTTTTAAACTGCTAATTTGTGTTC

AATTTATGGAACAATTTTTAATGAATTGATGTATTTTATAAGAGCACACCATAATGGTTAGAGCATTAAACTCCACTGCAAACCCTCTGGGCCCATATGA

CTTTTCTGCTAGTAACTACTATCTTGTGTCTTCTAACATCATATGTTTAAGATTAAGTGACTTAATGTGTATAAAGTTCAGAGGAGATGACTACTGTGAA

ATTGTTAGCTACTGTTATGAATGATTTAGCACCTAATGATACTATTCATGGCAACTTCTGTCTTCTAAGGTTAACATAAAAATACAGGAAACAGCTGAAT

ATGAATTTCAAATAAATGATGAATATGTTT
Translation
MKHLVAAWLLVGLSLGVPQFGKG GDICNPNPCENGGICLSGLADDSFSCECPEGFAGPNCSSVVEVA ASDEEKPTSAG GPCIPNPCHNGGTCEISEA

YRGDTFIGYVCKCPRGFNGIHCQHN NINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYK KCSGPLGIEGGIISNQQITASSTHRALFGLQKWY

PYYARLNKKGLINAWTAAENDRWPWIQ INLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEM VFRGNVDNNTPYANSFTPP

IKAQYVRLYPQICRRHCTLRMELLGCELSG GCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQ LPCTL
Transcript ENSMUST00000043111
Sequence
ACACAGTGCGCTCCTGGCCTCAGGCTCGCTCCCCTCCAGCTCTCGCTTCATTGTTCTCCAAGTCAGAAGCCCCCGCAGCCGCCGCGGCAGCAGCGTGAGC

CGTAGTCACTGCTGGCCGCTTCGCCTGCGGTGCGCGCACGGAAATCGGGGAGCCAGGAACCCAAGGAGCCCGCGCTCCGCCCGCTGTGCCTCTGCTAGGA

CCCACTCGCAGCCCCAGCCTCTCTCAAGCGCACCCACCTCCGCGCACCCCAGCTCAGGCGAAGCTGGAGTGAGGGGTGAATCACCCTTTCTCTAGGGCCA

CCACTCTTTTATCGCCCTTCCCAAGAATTTGAGGAAGCGCTGCGGGAGGAAAGACGTCCTCTTGAATCTCTGACAGGGCGGGGTTTACTGCTGTCCTGCA

GGGCCGCCTCGCCTACTGTGCCCTCCGCTACGACCCCGGACCAGCCCAGGTCACGTCCGTGAGAAGGGATCATGAAGCACTTGGTAGCAGCCTGGCTTTT

GGTTGGACTCAGCCTCGGGGTGCCCCAGTTCGGCAAAG GTGACATTTGCAACCCGAACCCCTGTGAAAATGGTGGCATCTGTCTGTCAGGACTGGCTGA

TGATTCCTTTTCCTGTGAGTGTCCAGAAGGCTTCGCAGGTCCGAACTGCTCTAGTGTTGTGGAGGTTG GTCCCTGCATCCCTAACCCATGCCATAACGG

AGGAACCTGTGAGATAAGCGAAGCCTATCGAGGAGACACATTCATAGGCTATGTTTGTAAATGTCCTCGGGGATTTAATGGGATTCACTGTCAGCACA A

TATAAATGAATGTGAAGCTGAGCCTTGCAGAAATGGCGGAATATGTACCGACCTTGTTGCTAACTACTCTTGTGAATGCCCAGGAGAATTTATGGGACGA

AATTGTCAATATA AATGCTCTGGGCCATTGGGAATCGAAGGTGGGATCATATCTAATCAGCAAATCACAGCTTCATCTACTCACCGAGCTCTTTTTGGA

CTCCAGAAGTGGTATCCCTACTATGCTCGACTTAATAAGAAGGGCCTTATAAATGCCTGGACAGCTGCTGAAAATGACAGATGGCCATGGATTCAG ATA

AATTTGCAAAGAAAAATGAGAGTCACTGGTGTTATTACCCAAGGAGCAAAAAGGATTGGAAGCCCAGAGTACATAAAATCCTACAAAATTGCCTACAGCA

ATGACGGGAAGACCTGGGCAATGTACAAAGTAAAAGGCACCAATGAAGAGATG GTCTTTCGTGGAAATGTTGATAACAACACACCATATGCTAATTCTT

TCACACCCCCAATCAAAGCTCAGTATGTAAGACTCTACCCCCAAATTTGTCGAAGGCATTGTACTTTAAGAATGGAACTTCTTGGCTGTGAGCTCTCAG 

GCTGTTCAGAACCTTTGGGGATGAAATCAGGGCATATACAAGACTACCAGATCACTGCCTCCAGCGTCTTCAGAACACTCAACATGGACATGTTTACTTG

GGAACCAAGGAAAGCCAGGCTGGACAAGCAAGGCAAAGTAAATGCCTGGACTTCCGGCCATAACGACCAGTCACAATGGTTACAG GTTGATCTTCTTGT

CCCTACTAAGGTGACAGGCATCATTACACAAGGAGCTAAAGATTTTGGTCACGTGCAGTTTGTTGGGTCATACAAACTAGCTTACAGCAATGATGGAGAA

CACTGGATGGTGCACCAGGATGAAAAACAGAGAAAAGACAAG - UNI35231 - GTTTTTCAAGGCAATTTTGACAATGACACTCACAGGAAAAATGT

CATCGACCCTCCCATCTATGCACGATTCATAAGAATCCTTCCTTGGTCCTGGTATGGAAGGATCACTCTGCGGTCAGAGCTGCTGGGCTGCGCAGAGGAG

GAATGAAGTGCGGGGCCGCACATCCCACAATGCTTTTCTTTATTTTCCTATAAGTATCTCCACGAAATGAACTGTGTGAAGCTGATGGAAACTGCATTTG

TTTTTTTCAAAGTGTTCAAATTATGGTAGGCTACTGACTGTCTTTTTAGGAGTTCTAAGCTTGCCTTTTTAATAATTTAATTTGGTTTCCTTTGCTCAAC

TCTCTTATGTAATATCACACTGTCTGTGAGTTACTCTTCTTGTTCTCTGAATTCTATAGATTGGTTGAAGTATAGTAGGCAAAGCAAGTCTTCTTTTTAC

AGCAAAACTTAAAAACAATCTCACAGTCATCAGATGGAAGGGTTAAGGGAGAACTTTGGTCACTATTCAATTAACTCTTATAAAATGTTACAATGTTAGC

AATACAGTTTTTTGTTATGAATTTGATCATCTTGATTGTTTCCCTGTGTCTAATGCTGTTAGTATGTATTACAGAGACTTGGTGAAAATTATTTGATATG

CAGGACCATTAATATGACAATTCTAGTTTTATTTTTTTCACTTACAATAAAATACTAAGTTCTTTATGTTTAATTTTATATTATTTATATGCTACATAAA

CAGGCCAATATTCTTTGTCATTGCATTTTCTCCCTTTATTTACCTTAAAGTCCTGTTTTTATTTATAGACACAGAACATATATTAATATACGTTGAACAT

GATTGGATATCAGTAAATGCTTCTATATTAAACATTAATACATTGAATCTGAATTTTCATTTTTGAAGAAAGCTATATGCATTTCATTTCCAAAGGCTAT

CTGAGATTCCCTTGTTACAGTTTAGTGAAAAAGAACAGAAAAACACTATGGCCCTTGAATTTAAATCTTCATTTCTTTGAGATAACAGAATCACTATCTG

TGTGTTTAATACACTAGCAAATGTATGTGAGCCTACTGCTGCACAGCTGGGCTAAGTGCACTCAACAATTCTTTGCAAATTTCCACATTTCCTGTGAAAT

GAAAATTCCAATGCTGTTTAAAACCAGTGGTAGTTTCTGAAGAAAGCACATTGTAAAATTATTTGTGAGAAGCGACGTATTTACAAATGACAAAGTCATA

AAACATCTTCAGGATGAAAATTGATTTTTATTTCTTTTGCTTCAAAGGTCTTAGAAAAACTAAGCAATTATCATAACAGTTTGTTATTGATAATGGAGGC

ATCATTGACATATGTCTCAAATTAAAGCTCACACTGCCTCCATAAATGTCCTACATACCTAATTTATAAGCTTAACACATATTTATTTTATAAGGCTTTG

ACACAGAATTATTGGAGTTTTAAATTGAAGATCCAGGAAAGGAAAGGGTGGATGTGGATGAAATGCTAAAGAACTACACAACACTGCTATATTTTATTTT

ATTTTTGTCTTTAATATGTGTGCTGTATAAGCAAAGCCACTACTGTTATGTCCTGTCTGTTCACGTGTTCACAGCATCTCTCAATGATGTAAATATGAAG

CAGTCTTCAATCACAGTGAAGAATTGAAAGTGAAAGTCAATCACATTACTGTTTTAAATGACAGCAAATTCATTGTTCTATGGTAACTGTCAGGCCAAAT

GTTTCTCCTTGCCCACCTGCTTACTGCAACAGATTTGTTAAAAATCTGTTGATTTTCAGCATATAAAATGCTGAATAATTTTTAACATTTTCCCAAAAGA

AAACTGATATGCCCTCAATATTATTGTCCTAGAAAATGTTTTAAATTATTAATATAGAATATTTAAAATAGTATTTTTAATTAAAATAGTTATACATAGA

ATCACTTATGCCCTAAAGGTACATTTTCTGTCTTGCCATGGTCCTTGTTTCTATCAGTGATAACCATACTACTGAATTTGTAGCTGTTTTTCCTTGCAGA

TTCTTTATCCTTAATATAAAATTCCAGAAATTATGAATAATACGCTGTGCTGAAATACTTTTCAAAACTGTTCTTGATTTCATGTGGCACTGCTGGTACA

TGTTTAAAATTTGTTCTCCAAAGGAGTTGTTAGTAATGGTATCTGCTACTATTTACAAGGCTGGTGAGAGGCTTTCTCTTGCTTGTCCTCTTCCTCTCAG

CTTCATGCGCTACCTACAGCATAGCTTACGCAATGGATATGCGTTTGTCCACAAGGGTGCTTGCACAAAAATTAATGACATGTATTAGGGAGTAGCTTGT

ATCAGTGGCTTCAAGTCGAAACATGGAATTTTCATTTAGTTTTATTTGCAAGTAAAATTTTACAAACACACAACCTGGAATTCCCTACTCTTCACTATAC

TACATAATTATTATGAGATAATTTCATTGTATAGAAGATTATGAATTAATTAGCTTTAAAAATATCAATTTCATGTATTTTATTCTAATCATTTGTCACA

GACACTAATTCCAACTTTAGGGTTGACTTTCTCTCTGTGAATGTCTTCAGAAAGATAAGAATGGATCTTGAAGACCAGGCATTAATGACTATATCTTTGC

TAGACATCAAATTATGAAATATAACATTGAATGTTGTAGTCTGGTGTGTCTGTAAGGACAGAAATAACTAAGATACACATAACTTTTGCAAACTTTCAAG

CTGTGTAATATTCCAATGTTGTTGTTTTTTTTTTTGTAGATATACTTAAATCATGTAGGATGTTGTAAACTCAGTATGATCCTGTCTAGTCTTCAAACTT

AAAATAAACTTTTGAAAAACTGTGCTACTTTTGAAGTTGTGTTTTAAACATCTGTGTAAGAATGTACAAATTGTCTGTGGCTGCCCTTAACCTTCAACAT

ATGATTAGCTTAATTTGTATTTATATAGATTAACTAAATGCACAAAGAAAAAGAGATTATAATTGTATAATTATTTTAAAATATAAGACTGCAAAAGTGG

TTTTGCCAAGATTATAAAAATGTATAAATTTATCCATACCTTTTTATTTGCAGAGATTTTGCAAAATATTAATAATCCAATTGTTTTCTCCAAATATATA

TTTAGAGTAGTATACTATAAGACTGATAAATCTATTATTATTCATACAACATTTCTATTGCTTCTATTGTTCTTTCAAATTTATCATGCTCAGGAGTATA

TTGAAGGAAGCTGGTTGGTAATAAGCTACAATGTGACATGAATAATACATATTAGCCTCTAACTCCAGCTATTGCTTAATGAAAGTCTGAACATGTGGCT

TCTTTAAGAACAGTCTTTTCTGGTTCTGTAGAAGCCACGAGTAAAAAGGGGATGTGTAACTCTAACACTTCAATATTTTCTTAGGATTAAAAATTTAGAG

TAAAACTAAAGATATTAAAAGTTGTTTTCTTCAAGCAGATCTCTGGTAGATCAAGTTTCATGGTTTTGTATACCAACATGTTCCTATCAAAGTAAATTTT

AATATGAATGC
Translation
MKHLVAAWLLVGLSLGVPQFGKG GDICNPNPCENGGICLSGLADDSFSCECPEGFAGPNCSSVVEVG GPCIPNPCHNGGTCEISEAYRGDTFIGYVCK

CPRGFNGIHCQHN NINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYK KCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLI

NAWTAAENDRWPWIQ INLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEM VFRGNVDNNTPYANSFTPPIKAQYVRLYPQI

CRRHCTLRMELLGCELSG GCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQ VDLLVPTKVTGIITQGAK

DFGHVQFVGSYKLAYSNDGEHWMVHQDEKQRKDK - UNI35231 - VFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRITLRSELLGCAEEE
Transcript ENSMUST00000081769
Sequence
ACACAGTGCGCTCCTGGCCTCAGGCTCGCTCCCCTCCAGCTCTCGCTTCATTGTTCTCCAAGTCAGAAGCCCCCGCAGCCGCCGCGGCAGCAGCGTGAGC

CGTAGTCACTGCTGGCCGCTTCGCCTGCGGTGCGCGCACGGAAATCGGGGAGCCAGGAACCCAAGGAGCCCGCGCTCCGCCCGCTGTGCCTCTGCTAGGA

CCCACTCGCAGCCCCAGCCTCTCTCAAGCGCACCCACCTCCGCGCACCCCAGCTCAGGCGAAGCTGGAGTGAGGGGTGAATCACCCTTTCTCTAGGGCCA

CCACTCTTTTATCGCCCTTCCCAAGAATTTGAGGAAGCGCTGCGGGAGGAAAGACGTCCTCTTGAATCTCTGACAGGGCGGGGTTTACTGCTGTCCTGCA

GGGCCGCCTCGCCTACTGTGCCCTCCGCTACGACCCCGGACCAGCCCAGGTCACGTCCGTGAGAAGGGATCATGAAGCACTTGGTAGCAGCCTGGCTTTT

GGTTGGACTCAGCCTCGGGGTGCCCCAGTTCGGCAAAG GTGACATTTGCAACCCGAACCCCTGTGAAAATGGTGGCATCTGTCTGTCAGGACTGGCTGA

TGATTCCTTTTCCTGTGAGTGTCCAGAAGGCTTCGCAGGTCCGAACTGCTCTAGTGTTGTGGAGGTTG CATCAGATGAAGAAAAGCCTACTTCAGCAG 

GTCCCTGCATCCCTAACCCATGCCATAACGGAGGAACCTGTGAGATAAGCGAAGCCTATCGAGGAGACACATTCATAGGCTATGTTTGTAAATGTCCTCG

GGGATTTAATGGGATTCACTGTCAGCACA ATATAAATGAATGTGAAGCTGAGCCTTGCAGAAATGGCGGAATATGTACCGACCTTGTTGCTAACTACTC

TTGTGAATGCCCAGGAGAATTTATGGGACGAAATTGTCAATATA AATGCTCTGGGCCATTGGGAATCGAAGGTGGGATCATATCTAATCAGCAAATCAC

AGCTTCATCTACTCACCGAGCTCTTTTTGGACTCCAGAAGTGGTATCCCTACTATGCTCGACTTAATAAGAAGGGCCTTATAAATGCCTGGACAGCTGCT

GAAAATGACAGATGGCCATGGATTCAG ATAAATTTGCAAAGAAAAATGAGAGTCACTGGTGTTATTACCCAAGGAGCAAAAAGGATTGGAAGCCCAGAG

TACATAAAATCCTACAAAATTGCCTACAGCAATGACGGGAAGACCTGGGCAATGTACAAAGTAAAAGGCACCAATGAAGAGATG GTCTTTCGTGGAAAT

GTTGATAACAACACACCATATGCTAATTCTTTCACACCCCCAATCAAAGCTCAGTATGTAAGACTCTACCCCCAAATTTGTCGAAGGCATTGTACTTTAA

GAATGGAACTTCTTGGCTGTGAGCTCTCAG GCTGTTCAGAACCTTTGGGGATGAAATCAGGGCATATACAAGACTACCAGATCACTGCCTCCAGCGTCT

TCAGAACACTCAACATGGACATGTTTACTTGGGAACCAAGGAAAGCCAGGCTGGACAAGCAAGGCAAAGTAAATGCCTGGACTTCCGGCCATAACGACCA

GTCACAATGGTTACAG GTTGATCTTCTTGTCCCTACTAAGGTGACAGGCATCATTACACAAGGAGCTAAAGATTTTGGTCACGTGCAGTTTGTTGGGTC

ATACAAACTAGCTTACAGCAATGATGGAGAACACTGGATGGTGCACCAGGATGAAAAACAGAGAAAAGACAAG - UNI35231 - GTTTTTCAAGGCA

ATTTTGACAATGACACTCACAGGAAAAATGTCATCGACCCTCCCATCTATGCACGATTCATAAGAATCCTTCCTTGGTCCTGGTATGGAAGGATCACTCT

GCGGTCAGAGCTGCTGGGCTGCGCAGAGGAGGAATGAAGTGCGGGGCCGCACATCCCACAATGCTTTTCTTTATTTTCCTATAAGTATCTCCACGAAATG

AACTGTGTGAAGCTGATGGAAACTGCATTTGTTTTTTTCAAAGTGTTCAAATTATGGTAGGCTACTGACTGTCTTTTTAGGAGTTCTAAGCTTGCCTTTT

TAATAATTTAATTTGGTTTCCTTTGCTCAACTCTCTTATGTAATATCACACTGTCTGTGAGTTACTCTTCTTGTTCTCTGAATTCTATAGATTGGTTGAA

GTATAGTAGGCAAAGCAAGTCTTCTTTTTACAGCAAAACTTAAAAACAATCTCACAGTCATCAGATGGAAGGGTTAAGGGAGAACTTTGGTCACTATTCA

ATTAACTCTTATAAAATGTTACAATGTTAGCAATACAGTTTTTTGTTATGAATTTGATCATCTTGATTGTTTCCCTGTGTCTAATGCTGTTAGTATGTAT

TACAGAGACTTGGTGAAAATTATTTGATATGCAGGACCATTAATATGACAATTCTAGTTTTATTTTTTTCACTTACAATAAAATACTAAGTTCTTTATGT

TTAATTTTATATTATTTATATGCTACATAAACAGGCCAATATTCTTTGTCATTGCATTTTCTCCCTTTATTTACCTTAAAGTCCTGTTTTTATTTATAGA

CACAGAACATATATTAATATACGTTGAACATGATTGGATATCAGTAAATGCTTCTATATTAAACATTAATACATTGAATCTGAATTTTCATTTTTGAAGA

AAGCTATATGCATTTCATTTCCAAAGGCTATCTGAGATTCCCTTGTTACAGTTTAGTGAAAAAGAACAGAAAAACACTATGGCCCTTGAATTTAAATCTT

CATTTCTTTGAGATAACAGAATCACTATCTGTGTGTTTAATACACTAGCAAATGTATGTGAGCCTACTGCTGCACAGCTGGGCTAAGTGCACTCAACAAT

TCTTTGCAAATTTCCACATTTCCTGTGAAATGAAAATTCCAATGCTGTTTAAAACCAGTGGTAGTTTCTGAAGAAAGCACATTGTAAAATTATTTGTGAG

AAGCGACGTATTTACAAATGACAAAGTCATAAAACATCTTCAGGATGAAAATTGATTTTTATTTCTTTTGCTTCAAAGGTCTTAGAAAAACTAAGCAATT

ATCATAACAGTTTGTTATTGATAATGGAGGCATCATTGACATATGTCTCAAATTAAAGCTCACACTGCCTCCATAAATGTCCTACATACCTAATTTATAA

GCTTAACACATATTTATTTTATAAGGCTTTGACACAGAATTATTGGAGTTTTAAATTGAAGATCCAGGAAAGGAAAGGGTGGATGTGGATGAAATGCTAA

AGAACTACACAACACTGCTATATTTTATTTTATTTTTGTCTTTAATATGTGTGCTGTATAAGCAAAGCCACTACTGTTATGTCCTGTCTGTTCACGTGTT

CACAGCATCTCTCAATGATGTAAATATGAAGCAGTCTTCAATCACAGTGAAGAATTGAAAGTGAAAGTCAATCACATTACTGTTTTAAATGACAGCAAAT

TCATTGTTCTATGGTAACTGTCAGGCCAAATGTTTCTCCTTGCCCACCTGCTTACTGCAACAGATTTGTTAAAAATCTGTTGATTTTCAGCATATAAAAT

GCTGAATAATTTTTAACATTTTCCCAAAAGAAAACTGATATGCCCTCAATATTATTGTCCTAGAAAATGTTTTAAATTATTAATATAGAATATTTAAAAT

AGTATTTTTAATTAAAATAGTTATACATAGAATCACTTATGCCCTAAAGGTACATTTTCTGTCTTGCCATGGTCCTTGTTTCTATCAGTGATAACCATAC

TACTGAATTTGTAGCTGTTTTTCCTTGCAGATTCTTTATCCTTAATATAAAATTCCAGAAATTATGAATAATACGCTGTGCTGAAATACTTTTCAAAACT

GTTCTTGATTTCATGTGGCACTGCTGGTACATGTTTAAAATTTGTTCTCCAAAGGAGTTGTTAGTAATGGTATCTGCTACTATTTACAAGGCTGGTGAGA

GGCTTTCTCTTGCTTGTCCTCTTCCTCTCAGCTTCATGCGCTACCTACAGCATAGCTTACGCAATGGATATGCGTTTGTCCACAAGGGTGCTTGCACAAA

AATTAATGACATGTATTAGGGAGTAGCTTGTATCAGTGGCTTCAAGTCGAAACATGGAATTTTCATTTAGTTTTATTTGCAAGTAAAATTTTACAAACAC

ACAACCTGGAATTCCCTACTCTTCACTATACTACATAATTATTATGAGATAATTTCATTGTATAGAAGATTATGAATTAATTAGCTTTAAAAATATCAAT

TTCATGTATTTTATTCTAATCATTTGTCACAGACACTAATTCCAACTTTAGGGTTGACTTTCTCTCTGTGAATGTCTTCAGAAAGATAAGAATGGATCTT

GAAGACCAGGCATTAATGACTATATCTTTGCTAGACATCAAATTATGAAATATAACATTGAATGTTGTAGTCTGGTGTGTCTGTAAGGACAGAAATAACT

AAGATACACATAACTTTTGCAAACTTTCAAGCTGTGTAATATTCCAATGTTGTTGTTTTTTTTTTTGTAGATATACTTAAATCATGTAGGATGTTGTAAA

CTCAGTATGATCCTGTCTAGTCTTCAAACTTAAAATAAACTTTTGAAAAACTGTGCTACTTTTGAAGTTGTGTTTTAAACATCTGTGTAAGAATGTACAA

ATTGTCTGTGGCTGCCCTTAACCTTCAACATATGATTAGCTTAATTTGTATTTATATAGATTAACTAAATGCACAAAGAAAAAGAGATTATAATTGTATA

ATTATTTTAAAATATAAGACTGCAAAAGTGGTTTTGCCAAGATTATAAAAATGTATAAATTTATCCATACCTTTTTATTTGCAGAGATTTTGCAAAATAT

TAATAATCCAATTGTTTTCTCCAAATATATATTTAGAGTAGTATACTATAAGACTGATAAATCTATTATTATTCATACAACATTTCTATTGCTTCTATTG

TTCTTTCAAATTTATCATGCTCAGGAGTATATTGAAGGAAGCTGGTTGGTAATAAGCTACAATGTGACATGAATAATACATATTAGCCTCTAACTCCAGC

TATTGCTTAATGAAAGTCTGAACATGTGGCTTCTTTAAGAACAGTCTTTTCTGGTTCTGTAGAAGCCACGAGTAAAAAGGGGATGTGTAACTCTAACACT

TCAATATTTTCTTAGGATTAAAAATTTAGAGTAAAACTAAAGATATTAAAAGTTGTTTTCTTCAAGCAGATCTCTGGTAGATCAAGTTTCATGGTTTTGT

ATACCAACATGTTCCTATCAAAGTAAATTTTAATATGAATGC
Translation
MKHLVAAWLLVGLSLGVPQFGKG GDICNPNPCENGGICLSGLADDSFSCECPEGFAGPNCSSVVEVA ASDEEKPTSAG GPCIPNPCHNGGTCEISEA

YRGDTFIGYVCKCPRGFNGIHCQHN NINECEAEPCRNGGICTDLVANYSCECPGEFMGRNCQYK KCSGPLGIEGGIISNQQITASSTHRALFGLQKWY

PYYARLNKKGLINAWTAAENDRWPWIQ INLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEEM VFRGNVDNNTPYANSFTPP

IKAQYVRLYPQICRRHCTLRMELLGCELSG GCSEPLGMKSGHIQDYQITASSVFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQ VDLLVP

TKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWMVHQDEKQRKDK - UNI35231 - VFQGNFDNDTHRKNVIDPPIYARFIRILPWSWYGRITLRS

ELLGCAEEE

For any suggestions or comments, please send an email to unitrap@crg.es