Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034543 (Morc2a)
Chromosomal location
Chr 11: 3549497 - 3590480 (+)
Description
microrchidia 2A Gene [Source:MGI (curated);Acc:Morc2a-001]
RefSeq_peptide
NP_937805.1 
UniGene
Mm.397725 Mm.139127 
MGI
MGI:1921772 
Uniprot/SWISSPROT
Q69ZX6 
Uniprot/SPTREMBL
Q5QNQ8 Q6PCN6 
Human Ortholog
ENSG00000133422 (MORC2)
Omim not available
UniTrap UNI33189
Vector Insertion
Chr 11: 3550451 - 3558674
Public Clones IST12058G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9221
Vector Insertion
Chr 11: 3558729 - 3561831
Public Clones RRC185 (baygenomics)
Private Clones OST220353 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26766
Vector Insertion
Chr 11: 3561867 - 3568773
Public Clones not available
Private Clones OST98768 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8118
Vector Insertion
Chr 11: 3586073 - 3588113
Public Clones RRG193 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8121
Vector Insertion
Chr 11: 3588303 - 3589037
Public Clones RRG198 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 98% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000096441
Sequence
GAAATTTTTTTTTTATGTGTCACTAAGAAGCACAAATTTACCCTTTACTGATCAGAATCCTGGGGAAATCGATTTCACTATATGTACTTTCCTGTTAACC

GGCAAAGACTGAAGACTCATTGCTGTCATGGCCTTCACCAATTACAGCAGTCTCAACCGAGCTCAACTAACCTTTGAATATCTCCACACAAATTC - UN

I33189 - AACCACTCATGAATTCTTATTTGGTGCTCTTGCTGAACTGGTTGATAATGCAAG - UNI9221 - AGATGCTGATGCTACCAGAATAGA

CATTTATGCTG - UNI26766 - AGAGGCGGGAGGACCTTCGAGGAGGATTTATGCTTTGCTTTTTGGATGATGGAGCAGGAATGGATCCAA GTGAT

GCTGCTAGTGTGATCCAGTTTGGGAAGTCAGCCAAAAGAACTCCTGAGTCCACTCAAATTGGGCAGTATGGCAATGGATTAAAATC GGGCTCAATGCGG

ATTGGGAAGGATTTTATCCTTTTCACTAAGAAGGAAGATACCATGACCTGCCTCTTCTTGTCTCGCACCTTTCATGAGGAAGAAGGCATTGATGAA GTA

ATTGTCCCATTGCCCACCTGGAATGCTCGAACACGGGAACCTATCACAGACAATGTGGAGAAGTTTGCCATTGAGACAGAGCTTGTCTACAAATACTCTC

CCTTCCACACTGAGGAGCAAGTGATGAACCAGTTCATGAAGATTCCTGGGAATAGTG GAACACTGGTGATCATCTTTAATCTCAAGCTCATGGATAATG

GAGAGCCGGAACTAGACATAATCTCAAATCCAAAAGATATCCAGATGGCAGAAACCTCGCCAGAGGGCAC GAAGCCAGAGCGACGCTCCTTCCGAGCCT

ATGCTGCTGTACTCTATATTGATCCCCGGATGAGGATCTTCATCCATGGACACAAGGTGCAGACCAAGAGACTCTCCTGCTGCCTATATAAGCCCAG GA

TGTACAAGTATACATCAAGTCGTTTCAAGACTCGGGCAGAACAGGAAGTGAAGAAAGCAGAGCATGTAGCACGGATTG CTGAAGAGAAGGCCCGGGAGG

CAGAGAGCAAAGCTCGTACTTTAGAAGTACGCATGGGTGGAGACCTGACACGGGACTCCAGG GTGATGTTGCGGCAGGTCCAGAATACAGCCATCACCC

TTCGTAGAGAAGCTGATGTCAAGAAAAGGATCAAGGATGCCAAGCAGCG AGCTCTCAAAGAACCCAAGGAACTTAATTTTGTTTTTGGGGTCAATATTG

AACACCGGGACTTAGATGGCATGTTTATCTACAACTGTAGCCGCCTGATCAAGATGTATGAGAAAGTGGGCCCACAGCTGGAAGGGGGCAT GGCATGTG

GTGGGGTTGTTGGGGTTGTTGATGTACCCTACTTGGTTCTGGAGCCTACACATAACAAGCAGGACTTTGCTGATGCTAAGGAGTACCGGCATCTACTTCG

AGCAATGGGGGAGCACTTGGCACAGTACTGGAAGGACATAGCCATTG CCCAGCGTGGAATCATCAAGTTTTGGGATGAGTTTGGCTATCTTTCTGCCAA

CTGGAACCAACCTCCATCTAGTGAGCTGCGTTTCAAACGCCGGAGAGCTATGGAAATTCCAACCACTATCCAGTGTG ATCTGTGTCTGAAATGGAGGAC

TCTCCCCTTCCAGCTGAGTTCAGTAGAAACAGATTACCCTGATACTTGGGTTTGCTCCATGAACCCTGATCCTGAGCAGGACCG CTGTGAAGCTTCTGA

ACAGAAGCAAAAGGTTCCTTTGGGGACATTAAAAAAGGACCCAAAGACACAGGAAGAAAAGCAGAAGCAGCTGACAGAGAAAATTCGCCAGCAGCAGGAA

AAGCTAGAAGCTCTTCAG AAAACCACGCCCATCCGCTCACAAGCTGACCTGAAGAAATTGCCCTTAGAAGTGACTACAAGACCTATTGAA GAACCTGT

ACGGAGACCTCAGCGTCCTCGGTCACCTCCTTTACCTGCGGTGATCAAGAATGCTCCTAGCAGACCCCCTTCTATTCAGACTCCCAGACCAAGTACCCAG

CTCCGAAAGACGTCTGTTATCAGCCTTCCAAAACCACCCACTACAGCAGCCCGAGGAGAAACTAGTACTTCTAGGCTACTCCAGCCAACTGAGGCACCTC

GAAAGCCTGCAAACCCTCCCATCAAGACTGTACCCCGACCCACCCCTCCTGTGCACACACCCCCACTATCTTTAATCCCCAGTTCCAAGAGCCTTCGGGA

GGTCCCTGCTCAAAAAGCCATCAAAACTCCAGTGGTCAAGAAGCCAGAGCCACCTGTCAAACAGTCCGTG GCAACCTCAGGTCGGAAGCGGAGTCTTGC

AGTCTCAGATGAGGAAGAGGCTGAAGAAGAAGCTGAGAAGAGGAGAGAGAGATGCAAGCGGGGCAAACTTGCTGTGAAGGAGGAAAAGAAGGAAGCAAAT

GAG CTCTCAGACAGTGCTGGGGAAGATCACCCAGCTGAACTCAGGAAGGCTCAGAAAG ATAAAGGACTTCATGTAGAGGTCCGTGTGAACCGTGAGTG

GTACACAGGCCGAGTCACAGCTGTGGAGGTGGGCAAGAATGCGGTTCGATGGAAAGTGAAGTTTGACTATGTGCCCACAGATACAACACCAAGAGACCGC

TG GGTGGAGAAAGGCAGTGAAGATGTACGATTGATGAAGCCACCTTCCCCAGAGCATCAGAGCCCTGACACACAGCAAGAAGGTGGAGAGGAGGAGGAG

GCTATGGTGGCCCGGCAGGCTGTGGCCTTGCCTGAGCCTTCCACCTCTGATGGTCTTCCCATTGAGCCTGATACCACTGCCACCAGTCCCAGCCATGAGA

CTATTGATCTCCTGGTCCAGATTCTTCG AAATTGCTTGCGGTATTTCTTACCTCCAAGTTTCCCCATCTCCAAGAAGGAGCTGAGTGTTATGAATTCAG

AAGAACTAATATCTTTTCCTCTG - UNI8118 - AAAGAATACTTCAAGCAATATGAGGTGGGGCTCCAGAATCTGTGCCATTCCTACCAAAGCCGTG

CTGATTCACGGGCAAAAGCCTCAGAGGAGAGCTTACGCACATCAGAGAAAAAGCTTCGTGAGACAGAGGAGAAGTTACAGAAGTTGAGGACCAACATTGT

AGCACTCCTGCAAAAAGTGCAGGAG - UNI8121 - GACATAGACATCAACACAGATGATGAGCTGGATGCTTACATTGAGGACCTCATCACCAAAGG

GGACTGAGGAGCCGGGAGGCTAACTCCTGCTCATACCTGCCCTCAACACAGCAGCTTCGGGGAGGGGAGTTCATTTGTGACTTGGTGGACTTGATCTTGG

TTTGAGTCATGTGAGACATTTGTGCTTTGGGAAGGAGATTCTTTGAATCTTCTTCCCTAAGTTTACATAAATATTTATTTTTTAAAAGAGAAGATGTTAA

TGCCTGCTGTGAGACCGTACTTTTTTTTGTGTGACTCTTGAAAGGGCACAGAGTCTGAACCATTCAGCTCCTGGCACCTCAACATAGGATGAAGAAAGCA

CCATCCTGAAGTTGGAGAGGCTCTAAGGACATCAACAATGGGATATGAAAGATACATGGCCCCAGGGACTCAGCTCTGCAAGACCCTCAAGGGGTGATCA

AAACAGGCCCAGTATCAGAAAGACACTCCCTGTAACAGATCTCCTGGTGTCCAGACAGGGCTGTGAAGGTCTGTAGGCTGCCTGAGCAGCTGTCAGTCAT

CTTGGATGTGACAGTATCCAGACAGCTTGGAGATGTTTCTTAAGGCTCAAATTTCCCAATATGCCACCTACTTTGTTACTGGAGGAGCCATTTCCTGAGT

CAACCACACTATCCAAGCTCAAGCATAGACAGCTCTGACCGGTCAGATCCCTGGGCTGGATAGCACTCTGAATGTTGAACTCCAAAGATTCTCAGGGTGT

GCAGGTGTGAAAGCTCTCTGGAGGAGAAGGCTTCCACAGTGGTGCTAGTTCCTGGAGAGCCTTTGCTGCTGCTTTTCTACTATGTACTCTCTGGGCTCCA

GAGAGCCCTGCACCTCCCATGCTCTGGAGGTGAGGAGGACAGACCATGTGCTTCAGACAACCACTCAGAGCCAGAAAGGCACGAGCTTCATCTGATGGCT

GTCGGAAGAATTCTGGTTCCAGTCCCAACTCTTCACACTCCTGTTCAAGACTGATTTTGTACTCTTGATCCAAACCACCTTGGGATTTGTATCCATCAAG

GCAAGGCTGCCACCTTGTGTCCTGGGGTCTCTGCAGAAGATGGGGAAGTGTTGGTGAGGGAACTGTGCACATATGGCTGGAAGTGCCTGCTTGAGTTCTG

CCATCAGGTTGTTTAGGGGGGATAGCATTCAGAAGTTCTTCTCTGGAACATTCTCCAATAGATGGGTTTTAAGTTGGTGCACTTACCCCCACGGCTGCCC

CCATCCAACTTTCTGTTGACCCTATCCAGGCAGAGTATGATCCATTTTTTTCCATAAACCCACTGTTTAAAAGGAATTTGGCCCTGCATTTTTATTGGCA

GGTAATACTCATTTTGATTTTTTTTTTTTTTTACTTACACATGTAATCAAAATGTGTTACTATAAATTTCTACTGGTGAGA
Translation
MAFTNYSSLNRAQLTFEYLHTNS - UNI33189 - STTHEFLFGALAELVDNAR - UNI9221 - RDADATRIDIYAE - UNI26766 - ERRE

DLRGGFMLCFLDDGAGMDPS SDAASVIQFGKSAKRTPESTQIGQYGNGLKS SGSMRIGKDFILFTKKEDTMTCLFLSRTFHEEEGIDE VIVPLPTWN

ARTREPITDNVEKFAIETELVYKYSPFHTEEQVMNQFMKIPGNSG GTLVIIFNLKLMDNGEPELDIISNPKDIQMAETSPEGT TKPERRSFRAYAAVL

YIDPRMRIFIHGHKVQTKRLSCCLYKPR RMYKYTSSRFKTRAEQEVKKAEHVARIA AEEKAREAESKARTLEVRMGGDLTRDSR VMLRQVQNTAITL

RREADVKKRIKDAKQR RALKEPKELNFVFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLEGGM MACGGVVGVVDVPYLVLEPTHNKQDFADAKEYRH

LLRAMGEHLAQYWKDIAIA AQRGIIKFWDEFGYLSANWNQPPSSELRFKRRRAMEIPTTIQCD DLCLKWRTLPFQLSSVETDYPDTWVCSMNPDPEQD

R RCEASEQKQKVPLGTLKKDPKTQEEKQKQLTEKIRQQQEKLEALQ KTTPIRSQADLKKLPLEVTTRPIE EPVRRPQRPRSPPLPAVIKNAPSRPPS

IQTPRPSTQLRKTSVISLPKPPTTAARGETSTSRLLQPTEAPRKPANPPIKTVPRPTPPVHTPPLSLIPSSKSLREVPAQKAIKTPVVKKPEPPVKQSV 

ATSGRKRSLAVSDEEEAEEEAEKRRERCKRGKLAVKEEKKEANE LSDSAGEDHPAELRKAQKD DKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVKF

DYVPTDTTPRDRW WVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILR RNCLRYFLP

PSFPISKKELSVMNSEELISFPL - UNI8118 - KEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQE 

- UNI8121 - DIDINTDDELDAYIEDLITKGD
Transcript ENSMUST00000093389
Sequence
GTTCCAATTCCACGGGGAGGGACAAAGGCATCTGCGAGCTGCAGGCAACGCCCGATCGGATCTGGTGGTGCACTCGCCACTTTCCTCTGTTCTCCCAGGC

TCTGGGACTAACTCCTGTCTGTCGGTAGCGAGGAGGTGGCCACAGGACCCAGGCCTGGGAAGGCCCGAGGGCCCGAGGCCATCTTCTGAAGGGTGTGGGG

GAAGGGCGCACCTGAGGTGATTCGGGAGGGTAGGTTGTGAGGTGTTTCTGTGGGCCACTGTGAGTAATTTCACCCACAACCTGTGGTGATTGTGGCATAA

TAGCAAGCTGTGTTTGGGCGGGGTTTGGGAAAAGAAATCTGTCAGTCAGCACCAAGGACCTTTCTGTTGGAAAGCGGTGAAGCCAGAAGTAGCCTCCACT

CCACTGCACTGTCCAGTAGAGCACTCTTTTGAGGAGCCTGGTGTCTTCGGTGGTGACAAAGTCTTCGGTGGTAATGAAGTAGGTGAACCGTCAGAAGTAG

GTCAATTTCCTGAATTTAGGAGAACAGAAAAGGACTTGAACGTGAAGTTGAAGCTGTAAACCTCCAAGTTTGAAGACCATTCAGAACCGTTCACTTTTGA

TGTGCGTCGGAATTGTGTGAAGAAAGCTTGACCCCCCGGAGCACTTAAGGACA AATCCTGGGGAAATCGATTTCACTATATGTACTTTCCTGTTAACCG

GCAAAGACTGAAGACTCATTGCTGTCATGGCCTTCACCAATTACAGCAGTCTCAACCGAGCTCAACTAACCTTTGAATATCTCCACACAAATTC - UNI

33189 - AACCACTCATGAATTCTTATTTGGTGCTCTTGCTGAACTGGTTGATAATGCAAG - UNI9221 - AGATGCTGATGCTACCAGAATAGAC

ATTTATGCTG - UNI26766 - AGAGGCGGGAGGACCTTCGAGGAGGATTTATGCTTTGCTTTTTGGATGATGGAGCAGGAATGGATCCAA GTGATG

CTGCTAGTGTGATCCAGTTTGGGAAGTCAGCCAAAAGAACTCCTGAGTCCACTCAAATTGGGCAGTATGGCAATGGATTAAAATC GGGCTCAATGCGGA

TTGGGAAGGATTTTATCCTTTTCACTAAGAAGGAAGATACCATGACCTGCCTCTTCTTGTCTCGCACCTTTCATGAGGAAGAAGGCATTGATGAA GTAA

TTGTCCCATTGCCCACCTGGAATGCTCGAACACGGGAACCTATCACAGACAATGTGGAGAAGTTTGCCATTGAGACAGAGCTTGTCTACAAATACTCTCC

CTTCCACACTGAGGAGCAAGTGATGAACCAGTTCATGAAGATTCCTGGGAATAGTG GAACACTGGTGATCATCTTTAATCTCAAGCTCATGGATAATGG

AGAGCCGGAACTAGACATAATCTCAAATCCAAAAGATATCCAGATGGCAGAAACCTCGCCAGAGGGCAC GAAGCCAGAGCGACGCTCCTTCCGAGCCTA

TGCTGCTGTACTCTATATTGATCCCCGGATGAGGATCTTCATCCATGGACACAAGGTGCAGACCAAGAGACTCTCCTGCTGCCTATATAAGCCCAG GAT

GTACAAGTATACATCAAGTCGTTTCAAGACTCGGGCAGAACAGGAAGTGAAGAAAGCAGAGCATGTAGCACGGATTG CTGAAGAGAAGGCCCGGGAGGC

AGAGAGCAAAGCTCGTACTTTAGAAGTACGCATGGGTGGAGACCTGACACGGGACTCCAGG GTGATGTTGCGGCAGGTCCAGAATACAGCCATCACCCT

TCGTAGAGAAGCTGATGTCAAGAAAAGGATCAAGGATGCCAAGCAGCG AGCTCTCAAAGAACCCAAGGAACTTAATTTTGTTTTTGGGGTCAATATTGA

ACACCGGGACTTAGATGGCATGTTTATCTACAACTGTAGCCGCCTGATCAAGATGTATGAGAAAGTGGGCCCACAGCTGGAAGGGGGCAT GGCATGTGG

TGGGGTTGTTGGGGTTGTTGATGTACCCTACTTGGTTCTGGAGCCTACACATAACAAGCAGGACTTTGCTGATGCTAAGGAGTACCGGCATCTACTTCGA

GCAATGGGGGAGCACTTGGCACAGTACTGGAAGGACATAGCCATTG CCCAGCGTGGAATCATCAAGTTTTGGGATGAGTTTGGCTATCTTTCTGCCAAC

TGGAACCAACCTCCATCTAGTGAGCTGCGTTTCAAACGCCGGAGAGCTATGGAAATTCCAACCACTATCCAGTGTG ATCTGTGTCTGAAATGGAGGACT

CTCCCCTTCCAGCTGAGTTCAGTAGAAACAGATTACCCTGATACTTGGGTTTGCTCCATGAACCCTGATCCTGAGCAGGACCG CTGTGAAGCTTCTGAA

CAGAAGCAAAAGGTTCCTTTGGGGACATTAAAAAAGGACCCAAAGACACAGGAAGAAAAGCAGAAGCAGCTGACAGAGAAAATTCGCCAGCAGCAGGAAA

AGCTAGAAGCTCTTCAG AAAACCACGCCCATCCGCTCACAAGCTGACCTGAAGAAATTGCCCTTAGAAGTGACTACAAGACCTATTGAA GAACCTGTA

CGGAGACCTCAGCGTCCTCGGTCACCTCCTTTACCTGCGGTGATCAAGAATGCTCCTAGCAGACCCCCTTCTATTCAGACTCCCAGACCAAGTACCCAGC

TCCGAAAGACGTCTGTTATCAGCCTTCCAAAACCACCCACTACAGCAGCCCGAGGAGAAACTAGTACTTCTAGGCTACTCCAGCCAACTGAGGCACCTCG

AAAGCCTGCAAACCCTCCCATCAAGACTGTACCCCGACCCACCCCTCCTGTGCACACACCCCCACTATCTTTAATCCCCAGTTCCAAGAGCCTTCGGGAG

GTCCCTGCTCAAAAAGCCATCAAAACTCCAGTGGTCAAGAAGCCAGAGCCACCTGTCAAACAGTCCGTG GCAACCTCAGGTCGGAAGCGGAGTCTTGCA

GTCTCAGATGAGGAAGAGGCTGAAGAAGAAGCTGAGAAGAGGAGAGAGAGATGCAAGCGGGGCAAACTTGCTGTGAAGGAGGAAAAGAAGGAAGCAAATG

AG CTCTCAGACAGTGCTGGGGAAGATCACCCAGCTGAACTCAGGAAGGCTCAGAAAG ATAAAGGACTTCATGTAGAGGTCCGTGTGAACCGTGAGTGG

TACACAGGCCGAGTCACAGCTGTGGAGGTGGGCAAGAATGCGGTTCGATGGAAAGTGAAGTTTGACTATGTGCCCACAGATACAACACCAAGAGACCGCT

G GGTGGAGAAAGGCAGTGAAGATGTACGATTGATGAAGCCACCTTCCCCAGAGCATCAGAGCCCTGACACACAGCAAGAAGGTGGAGAGGAGGAGGAGG

CTATGGTGGCCCGGCAGGCTGTGGCCTTGCCTGAGCCTTCCACCTCTGATGGTCTTCCCATTGAGCCTGATACCACTGCCACCAGTCCCAGCCATGAGAC

TATTGATCTCCTGGTCCAGATTCTTCG AAATTGCTTGCGGTATTTCTTACCTCCAAGTTTCCCCATCTCCAAGAAGGAGCTGAGTGTTATGAATTCAGA

AGAACTAATATCTTTTCCTCTG - UNI8118 - AAAGAATACTTCAAGCAATATGAGGTGGGGCTCCAGAATCTGTGCCATTCCTACCAAAGCCGTGC

TGATTCACGGGCAAAAGCCTCAGAGGAGAGCTTACGCACATCAGAGAAAAAGCTTCGTGAGACAGAGGAGAAGTTACAGAAGTTGAGGACCAACATTGTA

GCACTCCTGCAAAAAGTGCAGGAG - UNI8121 - GACATAGACATCAACACAGATGATGAGCTGGATGCTTACATTGAGGACCTCATCACCAAAGGG

GACTGAGGAGCCGGGAGGCTAACTCCTGCTCATACCTGCCCTCAACACAGCAGCTTCGGGGAGGGGAGTTCATTTGTGACTTGGTGGACTTGATCTTGGT

TTGAGTCATGTGAGACATTTGTGCTTTGGGAAGGAGATTCTTTGAATCTTCTTCCCTAAGTTTACATAAATATTTATTTTTTAAAAGAGAAGATGTTAAT

GCCTGCTGTGAGACCGTACTTTTTTTTGTGTGACTCTTGAAAGGGCACAGAGTCTGAACCATTCAGCTCCTGGCACCTCAACATAGGATGAAGAAAGCAC

CATCCTGAAGTTGGAGAGGCTCTAAGGACATCAACAATGGGATATGAAAGATACATGGCCCCAGGGACTCAGCTCTGCAAGACCCTCAAGGGGTGATCAA

AACAGGCCCAGTATCAGAAAGACACTCCCTGTAACAGATCTCCTGGTGTCCAGACAGGGCTGTGAAGGTCTGTAGGCTGCCTGAGCAGCTGTCAGTCATC

TTGGATGTGACAGTATCCAGACAGCTTGGAGATGTTTCTTAAGGCTCAAATTTCCCAATATGCCACCTACTTTGTTACTGGAGGAGCCATTTCCTGAGTC

AACCACACTATCCAAGCTCAAGCATAGACAGCTCTGACCGGTCAGATCCCTGGGCTGGATAGCACTCTGAATGTTGAACTCCAAAGATTCTCAGGGTGTG

CAGGTGTGAAAGCTCTCTGGAGGAGAAGGCTTCCACAGTGGTGCTAGTTCCTGGAGAGCCTTTGCTGCTGCTTTTCTACTATGTACTCTCTGGGCTCCAG

AGAGCCCTGCACCTCCCATGCTCTGGAGGTGAGGAGGACAGACCATGTGCTTCAGACAACCACTCAGAGCCAGAAAGGCACGAGCTTCATCTGATGGCTG

TCGGAAGAATTCTGGTTCCAGTCCCAACTCTTCACACTCCTGTTCAAGACTGATTTTGTACTCTTGATCCAAACCACCTTGGGATTTGTATCCATCAAGG

CAAGGCTGCCACCTTGTGTCCTGGGGTCTCTGCAGAAGATGGGGAAGTGTTGGTGAGGGAACTGTGCACATATGGCTGGAAGTGCCTGCTTGAGTTCTGC

CATCAGGTTGTTTAGGGGGGATAGCATTCAGAAGTTCTTCTCTGGAACATTCTCCAATAGATGGGTTTTAAGTTGGTGCACTTACCCCCACGGCTGCCCC

CATCCAACTTTCTGTTGACCCTATCCAGGCAGAGTATGATCCATTTTTTTCCATAAACCCACTGTTTAAAAGG
Translation
 MAFTNYSSLNRAQLTFEYLHTNS - UNI33189 - STTHEFLFGALAELVDNAR - UNI9221 - RDADATRIDIYAE - UNI26766 - ERR

EDLRGGFMLCFLDDGAGMDPS SDAASVIQFGKSAKRTPESTQIGQYGNGLKS SGSMRIGKDFILFTKKEDTMTCLFLSRTFHEEEGIDE VIVPLPTW

NARTREPITDNVEKFAIETELVYKYSPFHTEEQVMNQFMKIPGNSG GTLVIIFNLKLMDNGEPELDIISNPKDIQMAETSPEGT TKPERRSFRAYAAV

LYIDPRMRIFIHGHKVQTKRLSCCLYKPR RMYKYTSSRFKTRAEQEVKKAEHVARIA AEEKAREAESKARTLEVRMGGDLTRDSR VMLRQVQNTAIT

LRREADVKKRIKDAKQR RALKEPKELNFVFGVNIEHRDLDGMFIYNCSRLIKMYEKVGPQLEGGM MACGGVVGVVDVPYLVLEPTHNKQDFADAKEYR

HLLRAMGEHLAQYWKDIAIA AQRGIIKFWDEFGYLSANWNQPPSSELRFKRRRAMEIPTTIQCD DLCLKWRTLPFQLSSVETDYPDTWVCSMNPDPEQ

DR RCEASEQKQKVPLGTLKKDPKTQEEKQKQLTEKIRQQQEKLEALQ KTTPIRSQADLKKLPLEVTTRPIE EPVRRPQRPRSPPLPAVIKNAPSRPP

SIQTPRPSTQLRKTSVISLPKPPTTAARGETSTSRLLQPTEAPRKPANPPIKTVPRPTPPVHTPPLSLIPSSKSLREVPAQKAIKTPVVKKPEPPVKQSV

 ATSGRKRSLAVSDEEEAEEEAEKRRERCKRGKLAVKEEKKEANE LSDSAGEDHPAELRKAQKD DKGLHVEVRVNREWYTGRVTAVEVGKNAVRWKVK

FDYVPTDTTPRDRW WVEKGSEDVRLMKPPSPEHQSPDTQQEGGEEEEAMVARQAVALPEPSTSDGLPIEPDTTATSPSHETIDLLVQILR RNCLRYFL

PPSFPISKKELSVMNSEELISFPL - UNI8118 - KEYFKQYEVGLQNLCHSYQSRADSRAKASEESLRTSEKKLRETEEKLQKLRTNIVALLQKVQE

 - UNI8121 - DIDINTDDELDAYIEDLITKGD

For any suggestions or comments, please send an email to unitrap@crg.es