Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034544 (Rsrc1)
Chromosomal location
Chr 3: 66789594 - 67162325 (+)
Description
arginine/serine-rich coiled-coil 1 Gene [Source:MGI Symbol;Acc:MGI:1914130]
RefSeq_dna
NM_025822 
RefSeq_peptide
NP_080098.1 
UniGene
Mm.402719 Mm.316418 
MGI
MGI:1914130 
Uniprot/SWISSPROT
Q9DBU6 
Uniprot/SPTREMBL
Q8BR75 Q3TGY1 Q05CC1 Q9CSR8 Q80XR9 
Human Ortholog
ENSG00000174891 (RSRC1)
Omim not available
UniTrap UNI18113
Vector Insertion
Chr 3: 66798438 - 66798635
Public Clones not available
Private Clones OST429927 (lexicon) OST278698 (lexicon) OST168122 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1610
Vector Insertion
Chr 3: 66798635 - 66800386
Public Clones BB0200 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25703
Vector Insertion
Chr 3: 66800513 - 66886457
Public Clones not available
Private Clones OST169657 (lexicon) OST62954 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31864
Vector Insertion
Chr 3: 66886632 - 66984750
Public Clones (sanger) IST14038B7 (tigm) IST10871D12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7257
Vector Insertion
Chr 3: 66984788 - 67010347
Public Clones RRT189 (baygenomics) RRK430 (baygenomics) RRK168 (baygenomics) RRK166 (baygenomics)
RRK468 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 56% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5030
Vector Insertion
Chr 3: 67010400 - 67094268
Public Clones YTC483 (baygenomics) RRD131 (baygenomics) SYA264 (baygenomics) XG821 (baygenomics)
CSA170 (baygenomics) RRB031 (baygenomics) A057F04 (ggtc) W016H12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 64% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11833
Vector Insertion
Chr 3: 67094338 - 67153830
Public Clones A065B04 (ggtc) A068D06 (ggtc) IST11213A4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8142
Vector Insertion
Chr 3: 67153938 - 67155617
Public Clones RRG403 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000065047
Sequence
AGCTGCCTGGTGCTGGAACCAGGAAGGCGCTGAGCTTAAATTGAAGCAAGTTCTGAGGACGCCGGTGGCGCCGTGGTTAGAAGAGGGGGTTCCAGGTCCC

CACGTCGGGAGGTGCGAACCCGAAGGTCGAGCCAG - UNI18113 - AAATGGGACGCCGGTCTTCAGACACTGAAGAGGAAAGCAGAAGCAAGAGGA

AAAAGAAACACCGGAGGCGCTCGTCTTCAAGCAGCTCTTCAGACAGCAGGACATACAGCCGCAAGAAGGGCGGGAGGAGGCCGAGGTCCGACTCAAGGTC

CTGGTCTAGAGACCGCCAGCTTCGCTCGCATTCTTATGAGAGAAG - UNI1610 - - UNI18113 - ACGCAGGCGCAGATCAAGCAGCAGCTCTT

CTTATGGCTCCAGAAGGAAAAGAAGTCGCAGTCGTTCCAGGGGCCGAGGGAAACCCTATAGAGTTCAAAGGTCTCGGTCAAAAAGCAGAACCAGAAG - 

UNI25703 - - UNI31864 - GGATTCTGGAAACATCAAAGCTGGATTAGAACATCTG - UNI7257 - CCTCCAGCTGAGCAGGCCAAAGCCAG

ACTGCAATTGGTCCTTGAAGCTGCTG - UNI5030 - CAAAAGCTGATGAAGCATTAAAAGCCAAAGAAAGGAGTGAGGAAGAAGCAAAGAGAAGAAA

AGAAGAAG - UNI11833 - ACCAAGCCACCCTGGTAGAACAAGTCAAAAGAGTAAAGGAAATCGAAGCAATTGAAAGTGATTCTTTTGTTCAGCAGA

CATTCAGATCAAGTAAAGACGTCAAAAAG - UNI8142 - GTCCTGGGAAGACATGATGGGCTATCCTCACTGCATAGCAACGATTACCTCTGCTGA
Translation
 - UNI18113 - MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERR - UNI1610 - - UNI181

13 - RRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTRR - UNI25703 - - UNI31864 - RDSGNIKAGLEHL - UNI7257 -

 PPAEQAKARLQLVLEAAA - UNI5030 - AKADEALKAKERSEEEAKRRKEED - UNI11833 - DQATLVEQVKRVKEIEAIESDSFVQQTFRS

SKDVKK - UNI8142 - VLGRHDGLSSLHSNDYLC
Transcript ENSMUST00000046542
Sequence
AGCTGCCTGGTGCTGGAACCAGGAAGGCGCTGAGCTTAAATTGAAGCAAGTTCTGAGGACGCCGGTGGCGCCGTGGTTAGAAGAGGGGGTTCCAGGTCCC

CACGTCGGGAGGTGCGAACCCGAAGGTCGAGCCAG - UNI18113 - AAATGGGACGCCGGTCTTCAGACACTGAAGAGGAAAGCAGAAGCAAGAGGA

AAAAGAAACACCGGAGGCGCTCGTCTTCAAGCAGCTCTTCAGACAGCAGGACATACAGCCGCAAGAAGGGCGGGAGGAGGCCGAGGTCCGACTCAAGGTC

CTGGTCTAGAGACCGCCAGCTTCGCTCGCATTCTTATGAGAGAAG - UNI1610 - - UNI18113 - - UNI25703 - GTCCAGGTCAAGGCCT

CGTCCACGCTCACATAGTAGAAGCAGTGAAAGATCCAGTCACAGAAGAACCCGTAGCAGGTCCAGGGACAGAGACAGACGTAAAGTCCGGGACAAAGAGA

AAAGAGAAAAGGAGAAGGATAAAGGCAAAGACAAAGAAGTGCACAGCATCAAACGCGG - UNI31864 - GGATTCTGGAAACATCAAAGCTGGATTA

GAACATCTG - UNI7257 - CCTCCAGCTGAGCAGGCCAAAGCCAGACTGCAATTGGTCCTTGAAGCTGCTG - UNI5030 - CAAAAGCTGATGA

AGCATTAAAAGCCAAAGAAAGGAGTGAGGAAGAAGCAAAGAGAAGAAAAGAAGAAG - UNI11833 - ACCAAGCCACCCTGGTAGAACAAGTCAAAA

GAGTAAAGGAAATCGAAGCAATTGAAAGTGATTCTTTTGTTCAGCAGACATTCAGATCAAGTAAAGACGTCAAAAAG - UNI8142 - GCAGTAGAAC

CAAGTGAAGTGCAGCATGTGACTGCGGCATCAGGACCAGCATCCGCAGCTGCTGAGCCACCCAGCACTGGAAAGGAAATAGACCCTGACAGCATCCCCAC

GGCTATCAAGTACCAAGATGACAATTCTCTAGCTCATCCAAAT CTATTTATTGAAAAGGCCGAGGCTGAAGAAAAGTGGTTCAAGAGATTAATCGCTCT

CCGACAAGAAAGGCTGATGGGCAGTCCCGTGGCCTAAGCACGGACTTACGGTTGGATTGACAGTAACCTCGAAAACTTAGGTCGTAAAATTATATTACCA

ATATTAACTTTCACTCTTAAAAATAATTTAGCCAATTACATAAAAAAGAAATCTCATTTCTTCCCTCATGTTCAACTAAATATGTGGTAATTTGAATCTA

ACATTGTGAACAGTGAATCCGTTATAAAAGCTCTGAGTGCATGAAAACATATTTCACTATTAATAAAGTGAATAGTAAAAAATATTAGTGTTGAAATAAA

TGAACACTCAGTAGTGTTTCTCATTACAATTCTTACAAAGTCATGGTTTTCACCAACTATTAGATAATTTTCTTTACGAGGGCTATGTTATTTAGTGTGA

GAATGAGGTTTCATCTCCTGTATTATGAAACCCTTCTTGAATCCCTTAGCTCCCCTTTCTTAAGGTTTTTAGGTATCATAAAAGGTCCGCTAAGAAGTCT

AAGCAATGCCCATGTTAGATTTGAGGGCAACATGTTTTGTGTCAAGTGTGGACTCAGTCCTCTAACCCTAGGCCTTTGGAGGCTTAGGAGGGAAGGTCCC

AATTCCAGTCTACACTACACAGCAAGTATTGGGATACCTCGGGCTAAATGTTCATTAAATAAAGGAATCGTTTTTGCTTAGAGATCGATTTGTATCACGC

GTTCTTTTGAAACCTGTAACCTGACTTCAGTCTTTACCTGTGGAAATCATATGCCCAATATTTTAGTCATCACTGTGCATTGCTGTGACAGAAGACCTGG

CCTAACTTCAGGGAAAAGGTGTATTTTATTTCATCTTATAGTTTGAGCAATGTCAGGCCATGGTCAGCTGGCTCCACTGCGTGGAGGCCTGTAGCAGGCA

GAAACACTGCAAGAGGCCACGTCCCAGGAAAGCCACTCACTAATGCCTGTCGGGAAGCAAAGAGACAGGCAGGGGCTAAGGCCATGGTACTTCAGGGACA

TACTCCAGCCACCTGCTTCTAGTCTGTCCCCTACCTCCTGGTAGCTCACTCAGCTCTAAGTGCATGGTGCAGTCCATTGATAAAGTCCTCATGCTCCGGT

AACCGTCTCGGGACACCACCAGCACACGGCCAGGCTTTAAACATTTGAGCCTTTTGGAGACAGTTCATAGCCAGACCTTAATGCCCATGCTAGACTATGT

GCCTGACCCAGTGTCATGATGGAAAAAGAATTTCTGAGAAATAAGAGCTCTTGCAGCACTCCTGCTAGGCAGTGTCTGCCCCCTCCTGAGGAAGCCGCTG

TGTCGTGTGTAGAATGACATTCTCTAATAGACAAGCGTGGACATCTCTGAAGTCCATACCAAACATGCCAGAGGGAAGAGCTATGGGCCTTGCTGTACAA

AATGGGATTTCAACCCCTGGCACAAACACTTTTTTCCCCATTTTTCTCTGCTTGCTTTTACACTGACTCTCTGAAGACTGGAGCTGAGGGCACAGCCATG

GGAAGGCCCTGGGACATGAGGTCATTTAGATTCCATCTTTTTTACACTTTAGAGCTACTGAAGTTCTCTTCTCTGTTAAGGATGAAAAGTGGCAGGACCT

TACACTCAGTTGCAAGTACTATAAAAACGTTTATGTTAAAATGTTTGTTTTCATGTAGATGTTTTCTTGATCTAAGCAAAGGCTATTTTCCTTGGCTCTA

CAAATAAACATGCCGAGAATGAAGGAGGCCCATGTGGTTGTTAATGTGAACACGGCTATGCAGTAGGGATTTCGGAAGGGATTAATCTCAAATATTCTGC

TTTTTAATTCTTTATATTATTTGTAAACTGTGTGTTCCCATGCTATTAGGAAGTGTATATCTAGGAATGGATATACGCTATCAATGGGTCATAGGGAGTC

TTCCACACTTCTTCCATCTATACTGCAATAAAAATACTGTGATCTACTTTCTAGTATTCCTTCCCCCTAGGTTTCTCAATAACAGGTACACCAAATACAG

ATGCTTGAATTGTAACAAATTTGCATCTTAAAGATAAACTTTTTGTGGAAAATAAAAAAAGTCAAGCTTTGTTTGGTTTTCATTTGTTTTAAGTAAGCAA

ATAAACTTGGTCCTAAAGAACACTGTG
Translation
 - UNI18113 - MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERR - UNI1610 - - UNI181

13 - - UNI25703 - RSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDKEKREKEKDKGKDKEVHSIKRG - UNI31864 - GDSGNIKAG

LEHL - UNI7257 - PPAEQAKARLQLVLEAAA - UNI5030 - AKADEALKAKERSEEEAKRRKEED - UNI11833 - DQATLVEQVKRVKE

IEAIESDSFVQQTFRSSKDVKK - UNI8142 - AVEPSEVQHVTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPN LFIEKAEAEEKWF

KRLIALRQERLMGSPVA
Transcript ENSMUST00000065074
Sequence
AGCTGCCTGGTGCTGGAACCAGGAAGGCGCTGAGCTTAAATTGAAGCAAGTTCTGAGGACGCCGGTGGCGCCGTGGTTAGAAGAGGGGGTTCCAGGTCCC

CACGTCGGGAGGTGCGAACCCGAAGGTCGAGCCAG - UNI18113 - AAATGGGACGCCGGTCTTCAGACACTGAAGAGGAAAGCAGAAGCAAGAGGA

AAAAGAAACACCGGAGGCGCTCGTCTTCAAGCAGCTCTTCAGACAGCAGGACATACAGCCGCAAGAAGGGCGGGAGGAGGCCGAGGTCCGACTCAAGGTC

CTGGTCTAGAGACCGCCAGCTTCGCTCGCATTCTTATGAGAGAAG - UNI1610 - - UNI18113 - ACGCAGGCGCAGATCAAGCAGCAGCTCTT

CTTATGGCTCCAGAAGGAAAAGAAGTCGCAGTCGTTCCAGGGGCCGAGGGAAACCCTATAGAGTTCAAAGGTCTCGGTCAAAAAGCAGAACCAGAAG - 

UNI25703 - GTCCAGGTCAAGGCCTCGTCCACGCTCACATAGTAGAAGCAGTGAAAGATCCAGTCACAGAAGAACCCGTAGCAGGTCCAGGGACAGAG

ACAGACGTAAAGTCCGGGACAAAGAGAAAAGAGAAAAGGAGAAGGATAAAGGCAAAGACAAAGAAGTGCACAGCATCAAACGCGG - UNI31864 - G

GATTCTGGAAACATCAAAGCTGGATTAGAACATCTG - UNI7257 - CCTCCAGCTGAGCAGGCCAAAGCCAGACTGCAATTGGTCCTTGAAGCTGCT

G - UNI5030 - CAAAAGCTGATGAAGCATTAAAAGCCAAAGAAAGGAGTGAGGAAGAAGCAAAGAGAAGAAAAGAAGAAG - UNI11833 - ACC

AAGCCACCCTGGTAGAACAAGTCAAAAGAGTAAAGGAAATCGAAGCAATTGAAAGTGATTCTTTTGTTCAGCAGACATTCAGATCAAGTAAAGACGTCAA

AAAG - UNI8142 - GCAGTAGAACCAAGTGAAGTGCAGCATGTGACTGCGGCATCAGGACCAGCATCCGCAGCTGCTGAGCCACCCAGCACTGGAAA

GGAAATAGACCCTGACAGCATCCCCACGGCTATCAAGTACCAAGATGACAATTCTCTAGCTCATCCAAAT CTATTTATTGAAAAGGCCGAGGCTGAAGA

AAAGTGGTTCAAGAGATTAATCGCTCTCCGACAAGAAAGGCTGATGGGCAGTCCCGTGGCCTAAGCACGGACTTACGGTTGGATTGACAGTAACCTCGAA

AACTTAGGTCGTAAAATTATATTACCAATATTAACTTTCACTCTTAAAAATAATTTAGCCAATTACATAAAAAAGAAATCTCATTTCTTCCCTCATGTTC

AACTAAATATGTGGTAATTTGAATCTAACATTGTGAACAGTGAATCCGTTATAAAAGCTCTGAGTGCATGAAAACATATTTCACTATTAATAAAGTGAAT

AGTAAAAAATATTAGTGTTGAAATAAATGAACACTCAGTAGTGTTTCTCATTACAATTCTTACAAAGTCATGGTTTTCACCAACTATTAGATAATTTTCT

TTACGAGGGCTATGTTATTTAGTGTGAGAATGAGGTTTCATCTCCTGTATTATGAAACCCTTCTTGAATCCCTTAGCTCCCCTTTCTTAAGGTTTTTAGG

TATCATAAAAGGTCCGCTAAGAAGTCTAAGCAATGCCCATGTTAGATTTGAGGGCAACATGTTTTGTGTCAAGTGTGGACTCAGTCCTCTAACCCTAGGC

CTTTGGAGGCTTAGGAGGGAAGGTCCCAATTCCAGTCTACACTACACAGCAAGTATTGGGATACCTCGGGCTAAATGTTCATTAAATAAAGGAATCGTTT

TTGCTTAGAGATCGATTTGTATCACGCGTTCTTTTGAAACCTGTAACCTGACTTCAGTCTTTACCTGTGGAAATCATATGCCCAATATTTTAGTCATCAC

TGTGCATTGCTGTGACAGAAGACCTGGCCTAACTTCAGGGAAAAGGTGTATTTTATTTCATCTTATAGTTTGAGCAATGTCAGGCCATGGTCAGCTGGCT

CCACTGCGTGGAGGCCTGTAGCAGGCAGAAACACTGCAAGAGGCCACGTCCCAGGAAAGCCACTCACTAATGCCTGTCGGGAAGCAAAGAGACAGGCAGG

GGCTAAGGCCATGGTACTTCAGGGACATACTCCAGCCACCTGCTTCTAGTCTGTCCCCTACCTCCTGGTAGCTCACTCAGCTCTAAGTGCATGGTGCAGT

CCATTGATAAAGTCCTCATGCTCCGGTAACCGTCTCGGGACACCACCAGCACACGGCCAGGCTTTAAACATTTGAGCCTTTTGGAGACAGTTCATAGCCA

GACCTTAATGCCCATGCTAGACTATGTGCCTGACCCAGTGTCATGATGGAAAAAGAATTTCTGAGAAATAAGAGCTCTTGCAGCACTCCTGCTAGGCAGT

GTCTGCCCCCTCCTGAGGAAGCCGCTGTGTCGTGTGTAGAATGACATTCTCTAATAGACAAGCGTGGACATCTCTGAAGTCCATACCAAACATGCCAGAG

GGAAGAGCTATGGGCCTTGCTGTACAAAATGGGATTTCAACCCCTGGCACAAACACTTTTTTCCCCATTTTTCTCTGCTTGCTTTTACACTGACTCTCTG

AAGACTGGAGCTGAGGGCACAGCCATGGGAAGGCCCTGGGACATGAGGTCATTTAGATTCCATCTTTTTTACACTTTAGAGCTACTGAAGTTCTCTTCTC

TGTTAAGGATGAAAAGTGGCAGGACCTTACACTCAGTTGCAAGTACTATAAAAACGTTTATGTTAAAATGTTTGTTTTCATGTAGATGTTTTCTTGATCT

AAGCAAAGGCTATTTTCCTTGGCTCTACAAATAAACATGCCGAGAATGAAGGAGGCCCATGTGGTTGTTAATGTGAACACGGCTATGCAGTAGGGATTTC

GGAAGGGATTAATCTCAAATATTCTGCTTTTTAATTCTTTATATTATTTGTAAACTGTGTGTTCCCATGCTATTAGGAAGTGTATATCTAGGAATGGATA

TACGCTATCAATGGGTCATAGGGAGTCTTCCACACTTCTTCCATCTATACTGCAATAAAAATACTGTGATCTACTTTCTAGTATTCCTTCCCCCTAGGTT

TCTCAATAACAGGTACACCAAATACAGATGCTTGAATTGTAACAAATTTGCATCTTAAAGATAAACTTTTTGTGGAAAATAAAAAAAGTCAAGCTTTGTT

TGGTTTTCATTTGTTTTAAGTAAGCAAATAAACTTGGTCCTAAAGAACACTGTG
Translation
 - UNI18113 - MGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERR - UNI1610 - - UNI181

13 - RRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTRR - UNI25703 - RSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDK

EKREKEKDKGKDKEVHSIKRG - UNI31864 - GDSGNIKAGLEHL - UNI7257 - PPAEQAKARLQLVLEAAA - UNI5030 - AKADEALK

AKERSEEEAKRRKEED - UNI11833 - DQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKK - UNI8142 - AVEPSEVQHVTAASGPASAAA

EPPSTGKEIDPDSIPTAIKYQDDNSLAHPN LFIEKAEAEEKWFKRLIALRQERLMGSPVA
Transcript ENSMUST00000065115
Sequence
CCCCGCACCTTGCAGGGTCCCAGCCTGCTGGCTCTGGGCGAGGGGGTCGCCGGAGTGGTCGCGGGTGGCGAGCGGCCGCAGGCCCCAGGCTTGGCCTACA

GTGTGGAGTTGATGTGGAGAG - UNI18113 - AAATGGGACGCCGGTCTTCAGACACTGAAGAGGAAAGCAGAAGCAAGAGGAAAAAGAAACACCGG

AGGCGCTCGTCTTCAAGCAGCTCTTCAGACAGCAGGACATACAGCCGCAAGAAGGGCGGGAGGAGGCCGAGGTCCGACTCAAGGTCCTGGTCTAGAGACC

GCCAGCTTCGCTCGCATTCTTATGAGAGAAG - UNI1610 - - UNI18113 - ACGCAGGCGCAGATCAAGCAGCAGCTCTTCTTATGGCTCCAGA

AGGAAAAGAAGTCGCAGTCGTTCCAGGGGCCGAGGGAAACCCTATAGAGTTCAAAGGTCTCGGTCAAAAAGCAGAACCAGAAG - UNI25703 - GTC

CAGGTCAAGGCCTCGTCCACGCTCACATAGTAGAAGCAGTGAAAGATCCAGTCACAGAAGAACCCGTAGCAGGTCCAGGGACAGAGACAGACGTAAAGTC

CGGGACAAAGAGAAAAGAGAAAAGGAGAAGGATAAAGGCAAAGACAAAGAAGTGCACAGCATCAAACGCGG - UNI31864 - GGATTCTGGAAACAT

CAAAGCTGGATTAGAACATCTG - UNI7257 - CCTCCAGCTGAGCAGGCCAAAGCCAGACTGCAATTGGTCCTTGAAGCTGCTG - UNI5030 - 

CAAAAGCTGATGAAGCATTAAAAGCCAAAGAAAGGAGTGAGGAAGAAGCAAAGAGAAGAAAAGAAGAAG - UNI11833 - ACCAAGCCACCCTGGTA

GAACAAGTCAAAAGAGTAAAGGAAATCGAAGCAATTGAAAGTGATTCTTTTGTTCAGCAGACATTCAGATCAAGTAAAGACGTCAAAAAG - UNI8142

 - GCAGTAGAACCAAGTGAAGTGCAGCATGTGACTGCGGCATCAGGACCAGCATCCGCAGCTGCTGAGCCACCCAGCACTGGAAAGGAAATAGACCCTG

ACAGCATCCCCACGGCTATCAAGTACCAAGATGACAATTCTCTAGCTCATCCAAAT CTATTTATTGAAAAGGCCGAGGCTGAAGAAAAGTGGTTCAAGA

GATTAATCGCTCTCCGACAAGAAAGGCTGATGGGCAGTCCCGTGGCCTAAGCACGGACTTACGGTTGGATTGACAGTAACCTCGAAAACTTAGGTCGTAA

AATTATATTACCAATATTAACTTTCACTCTTAAAAATAATTTAGCCAATTACATAAAAAAGAAATCTCATTTCTTCCCTCATGTTCAACTAAATATGTGG

TAATTTGAATCTAACATTGTGAACAGTGAATCCGTTATAAAAGCTCTGAGTGCATGAAAACATATTTCACTATTAATAAAGTGAATAGTAAAAAATATTA

GTGTTGAAATAAATGAACACTCAGTAGTGTTTCTCATTACAATTCTTACAAAGTCATGGTTTTCACCAACTATTAGATAATTTTCTTTACGAGGGCTATG

TTATTTAGTGTGAGAATGAGGTTTCATCTCCTGTATTATGAAACCCTTCTTGAATCCCTTAGCTCCCCTTTCTTAAGGTTTTTAGGTATCATAAAAGGTC

CGCTAAGAAGTCTAAGCAATGCCCATGTTAGATTTGAGGGCAACATGTTTTGTGTCAAGTGTGGACTCAGTCCTCTAACCCTAGGCCTTTGGAGGCTTAG

GAGGGAAGGTCCCAATTCCAGTCTACACTACACAGCAAGTATTGGGATACCTCGGGCTAAATGTTCATTAAATAAAGGAATCGTTTTTGCTTAGAGATCG

ATTTGTATCACGCGTTCTTTTGAAACCTGTAACCTGACTTCAGTCTTTACCTGTGGAAATCATATGCCCAATATTTTAGTCATCACTGTGCATTGCTGTG

ACAGAAGACCTGGCCTAACTTCAGGGAAAAGGTGTATTTTATTTCATCTTATAGTTTGAGCAATGTCAGGCCATGGTCAGCTGGCTCCACTGCGTGGAGG

CCTGTAGCAGGCAGAAACACTGCAAGAGGCCACGTCCCAGGAAAGCCACTCACTAATGCCTGTCGGGAAGCAAAGAGACAGGCAGGGGCTAAGGCCATGG

TACTTCAGGGACATACTCCAGCCACCTGCTTCTAGTCTGTCCCCTACCTCCTGGTAGCTCACTCAGCTCTAAGTGCATGGTGCAGTCCATTGATAAAGTC

CTCATGCTCCGGTAACCGTCTCGGGACACCACCAGCACACGGCCAGGCTTTAAACATTTGAGCCTTTTGGAGACAGTTCATAGCCAGACCTTAATGCCCA

TGCTAGACTATGTGCCTGACCCAGTGTCATGATGGAAAAAGAATTTCTGAGAAATAAGAGCTCTTGCAGCACTCCTGCTAGGCAGTGTCTGCCCCCTCCT

GAGGAAGCCGCTGTGTCGTGTGTAGAATGACATTCTCTAATAGACAAGCGTGGACATCTCTGAAGTCCATACCAAACATGCCAGAGGGAAGAGCTATGGG

CCTTGCTGTACAAAATGGGATTTCAACCCCTGGCACAAACACTTTTTTCCCCATTTTTCTCTGCTTGCTTTTACACTGACTCTCTGAAGACTGGAGCTGA

GGGCACAGCCATGGGAAGGCCCTGGGACATGAGGTCATTTAGATTCCATCTTTTTTACACTTTAGAGCTACTGAAGTTCTCTTCTCTGTTAAGGATGAAA

AGTGGCAGGACCTTACACTCAGTTGCAAGTACTATAAAAACGTTTATGTTAAAATGTTTGTTTTCATGTAGATGTTTTCTTGATCTAAGCAAAGGCTATT

TTCCTTGGCTCTACAAATAAACATGCCGAGAATGAAGGAGGCCCATGTGGTTGTTAATGTGAACACGGCTATGCAGTAGGGATTTCGGAAGGGATTAATC

TCAAATATTCTGCTTTTTAATTCTTTATATTATTTGTAAACTGTGTGTTCCCATGCTATTAGGAAGTGTATATCTAGGAATGGATATACGCTATCAATGG

GTCATAGGGAGTCTTCCACACTTCTTCCATCTATACTGCAATAAAAATACTGTGATCTACTTTCTAGTATTCCTTCCCCCTAGGTTTCTCAATAACAGGT

ACACCAAATACAGATGCTTGAATTGTAACAAATTTGCATCTTAAAGATAAACTTTTTGTGGAAAATAAAAAAAGTCAAGCTTTGTTTGGTTTTCATTTGT

TTTAAGTAAGCAAATAAACTTGGTCCTAAAGAACACTGTG
Translation
PRTLQGPSLLALGEGVAGVVAGGERPQAPGLAYSVELMWRE - UNI18113 - EMGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRP

RSDSRSWSRDRQLRSHSYERR - UNI1610 - - UNI18113 - RRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTRR - UNI2570

3 - RSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDKEKREKEKDKGKDKEVHSIKRG - UNI31864 - GDSGNIKAGLEHL - UNI7257

 - PPAEQAKARLQLVLEAAA - UNI5030 - AKADEALKAKERSEEEAKRRKEED - UNI11833 - DQATLVEQVKRVKEIEAIESDSFVQQTF

RSSKDVKK - UNI8142 - AVEPSEVQHVTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPN LFIEKAEAEEKWFKRLIALRQERLMGS

PVA

For any suggestions or comments, please send an email to unitrap@crg.es