Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034551 (Hdx)
Chromosomal location
Chr X: 108683544 - 108810688 (-)
Description
highly divergent homeobox Gene [Source:MGI (curated);Acc:Hdx-002]
RefSeq_dna
NM_001080549 
RefSeq_peptide
NP_001074018.1 
UniGene
Mm.391307 Mm.449809 Mm.246623 
MGI
MGI:2685226 
Uniprot/SWISSPROT
Q14B70 
Human Ortholog
ENSG00000165259 (HDX)
Omim not available
UniTrap UNI31596
Vector Insertion
Chr X: 108784951 - 108810689
Public Clones IST13560H4 (tigm) IST10154F6 (tigm) IST14873E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1487
Vector Insertion
Chr X: 108763500 - 108773242
Public Clones CD0231 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17811
Vector Insertion
Chr X: 108714435 - 108735909
Public Clones not available
Private Clones OST436080 (lexicon)
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113422
Sequence
ATTGTCTGAGGCGGCAGTGGAGACCCAGGAAAAAATCTTGCGGACTCCGCCTGCTCTGGCCCTGGTCTCATCTTGGAACCTCTGATCTCTTTCGTGACCG

CACCACGCCCGAG - UNI31596 - ACGTGGGTTGGCAATAAGCGAAGAAAAATGAGTAGTAAAAGCTGTGAATCAGGAGCAGCAGGAACTGTGTCTG

GTACCTCATTGGCAGCGCCAGACATTACAGTCAGAAATGTGGTTAATATTGCCCGCCCTTCAAGCCAGCAATCTTCTTGGACTTCTGCCAATAATGATGT

CATTGTAACTGGTATATACAGTCCAGTAAGCTCATCAAGTAAGCAAGGCACTACAAAGCATACAAATACACAAATTACAGAAGCACATAAAATTCCTATT

CAGAAGGCAGCCAATAAAAATGACACTGAATTACAATTGCACATTCCTGTTCAAAGACAAGTAGCGCACTGTAAGAATGCTTCTGTGCTCCTAGGGGAAA

AGACAATTATTTTGTCAAGACAGACAAGTGTACTAAATGCTGGAAACTCAGTGTACAATCACACAAAGAAAAGCTATGGAAGTTCTCCGGTGCAAGCTTC

AGAAATGACAGTACCTCAAAAGCCATCTGTGTGCCAGCGACCTTGCAAAATTGAACCAGTTGGGATTCAAAGGTCATATAAACCTGAACATGCAGGTCTG

GCATCACATAACTTATGTGGGCAAAAGCCAACCATTAGAGACCCTTGCTGTAGAACACAAAACTTGGAAATTCGTGAAGTGTTTTCATTGGCAGTCAGTG

ATTACCCTCAGAGAATTCTGGGAGGAAATAGCACACAGAAGCCGGCCTCAGCAGAAGGAACTTGTTTGTCCATTGCAATGGAGACTGGAGACGCAGAGGA

TGAATATGCCAGAGAAGAAGAACTGGCATCAATGGGAGCACAAATAACAAGCTACTCAAGGTTTTATGAAAGTGGCAATTCCCTTCGAGCTGAGAACCAA

AGTACAAATTTGCCTGGACCAGGAAGAAACCTGCCAAATTCACAAATGGTGAATATTAGAGATTTGTCAGACAATGTACTGTATCAGACTAGAGACTACC

ATTTGACACCACGGACCTCATTGCATACAGCATCTAGTACTATGTACAGTAATACTAATCCATCACGGAGTAATTTTTCTCCACATTTTGTATCATCAAA

CCAACTGAGGTTATCACAAAACCAAAACAATTACCAG - UNI1487 - ATTTCAGGAAACCTTTCTGTGCCTTGGATTACAGGGTGTTCTAGGAAAAG

AGCA CTACAGGACCGCACTCAATTCAGTGACCGAGACTTGGCTACTCTTAAGAAGTACTGGGACAATGGTATGACCAGCCTGGGCTCTGTATGTAGAGA

GAAGATTGAAGCTGTTGCAATTGAATTAAATGTCGACTGTGAAATAGTTCGG - UNI17811 - ACTTGGATTGGGAATCGAAGAAGAAAATACCGTT

TAATGGGAATTGAAGTTCCACCTCCAAGAGGAGGCCCTGCTGATTTCTCTGAGCAGCCTGAGTCTGGTTCTTTGTCTGCACTCACACCAGGAGAGGAAGC

TGGGCCTGAAGTAGGAGAGGATAATGACAGAAATGATGAAGTGTCCATCTGTTTGTCCGAAGCAAGCTCTCAAG AGGAGTCCAATGAACTTATCCCAAA

TGAGACCAGGGCACATAAGGATGAAGAGCACCAGGCAGTATCTGCAGATAATGTG AAAATAGAAATTATCGATGATGAAGAAAGTGACATGATAAGCAA

TTCTGAGGTAGAACAAGAAAATTCTCTCCTGGATTACAAG AATGAAGAAGTCAGATTTATTGAAAATGAGCTAGAGATTCAAAAGCAAAAATACTTTAA

GCTCCAGTCTTTTGTTAGAAACCTGATTCTCGCTATGAAAGCTGATGATAAAGACCAGCAGCAG GCACTGCTGTCAGATTTACCTCCAGAATTAGAAGA

GATGGATTGCAGTCATGCCTCGCCGGATCCTGATGATACCTCACTCAGTGTGTCTTCTTTATCAGAGAAAAATGCCTCAGACAGCTTGTGATTGGGAGTG

GGGGATATGATCTAGTCTGTTGATTGCCTAACAGGTGTGCATTTCAAGATAACTGTACTGTTTCCCAAACAGTCTTCAACTGGAAAAACACATTGTTAAA

GCAAACATATGCTGTGAAGGAATGACAAGATATAGTGGCTACAATACAAAATAAAAAGCATGTACAATACTTGAAATGGTTTGTTTTTAAAACTTATATA

AAATCCTAGGAAATTGTATTTAATTTTGACCAACTCCACTATGAAATCTATTATATCTGATTTCTGAAAGATTTTTTTGCTTATTCTTTAAGAAGAATCT

TAATTTTATCCAGAAATATAGAAAATAAGCATATCACAACATTACTAAGTTGGTTAGTTTTATTTTGTAGCCATTACATCTTTCTTCCTACTTCATTTTC

TTATCATTCATATACATTTTTACTCAGGAAAGTGGGCTAAAAATTTACAACAGGCCTAATCATATATTTAACCTGGATGAATCCTGGGATTTATTTTTCA

ATTCCGATGAGAATTTGACCTAAGATAATGATTGAAAATTGAAGCACTTACTAGGACGTAATTGTAAGTTATTGGTACTCCTGACACTGGGGAGAGGGAA

AAATCCTCTGAAAAGTAGAATCATTGTCAAAATGTCAAAACATTTAAGTACATAAAAACTGTACTTTTTAAAAAACACTTTTAATCTCAATTCTTGTATA

CAATAAGTGATAAGTATTGATGATTAATATTCTACCATATAGTAAATTTATATAATTGAGTCAGACAAAATATTGCACAAATACTTCAAGTTTATCAACA

TTTTCATAATACTTTTCATATCTTAAAATTTGTGAAACAGGAAATCAAAGTATGGTACTGGTATCTGTTTGTTTTTATTTAATTCTAGACATACAACTTT

GCCACAAAGTTTACCTCATTTCCATATGAGGCCTGCACAAAGCCAACAATAATGTCAAAAAAATAATTATATATAATACTTTGATTGTAAATCAAAGTCC

TCTGGATCTCTTGGATGCTATTCTATGAATACACACCTAAAATGAGCATGGTACCCAGTTGTTACTATTAGTAGGTACCAAATGGCAGCACACTGTAGAC

ATCTTTTTGCATCTTCCCTTCTGGAATACCAGATGGTATTACTAAGGTCTGTCTATAGATGGAAAAATACTAGTTTCTGCCTAAACTCACAATGTCATAT

ATTTGTAACTAGGTTGTGTGGAACTATATTACACGATTAAATTATTATCTATTCCTGAAAGATGCATGAAGCATCTAGATAACTGTTTCAATTATCAAGT

TTCAGATATGTTTAAGTTTCTTAACTACAGCTATTCTGATCTCAGAATTTACTGATACCAATTTATGATTCCAGAAAGGCCCTTATTAATCCCTCTAGCT

CAGAAATGTCCTTTCTCATTACTATATACAAGTAAAGTTCACTGATGACCATTCAGTTCATCAAATGTTTGATTTTACACTGTTGCCACACAACCTCTAT

GGCTTCCTTGTCAGCAGAAATATTTCAGTAGTCAGCTAATCATGTCCTTTAGCTGAAAGTCATGTGGTTCTTTGCAAACAACTTCTGGTAGTCCTTGCTG

ACAAACCAAATTCCATTCAGGGAAAAGACCACTGAGCCACAGAAGCTCAAACATCTAGATTAAGCTCTTCAGTCACATAAATTTCTCCATAAAATAAGAG

TCCTCCCTACATACAACAAATACAGAAACCCTGATTATTTTATTATATGGAGGATTAAGACAAATTTTCCTGTAGCCCAATCTGGCCTCATATTTCCAAT

ATAGCTGAGGATGGCTTTGAGTCCTGCTGTTCCTGCCTTTGTTTCCCAAATGCCTGGATGGCAGATGTGCCCCACCACACCTAGGTTCCGTTTGTTTGAG

TAGGAACCCATTTCTGGTCTCAAGTCTCTCTGTGATCTTCTTTAGTACCATTGAGTTTCTCTTTAAACTGCTTCAGTTTAAGACACTTCCTAGTTGGTTT

TCATTACAGAACAAATGAAAACAACAAAAAATTATTTTCACATCTTAGAAATGTGTTACTACATTAAAAAAAAATCCTTGGAGCTCATTAAAAATATCCT

TGGAGCTCTCGCTATAGGAAAGATTCTGTGGCAGACACTGGAATTTTTAAATAATCTATGGACTATAAAAAGAATTATTTCAGCTGGGTACTAGGACACA

TAGTAACAACTCTAGCACTGGGTAGCCTGAGGAAAGCTGGCCTTCAAAACACAAAGAAATGTCTCCTGTTAACCTTTTCAAGTCTATTAATAAAAGTTTT

TCAACTAGCAGTTATAATTAATTTAAGGATTCTTATAGATGTGATTCTTAGAAAGAATGTTACATCTGTAATTTTGGGAGGATGCATAAATTGTTCTATT

CCTTTTTAAAGTTTCATTTAAATAGAAGCTGTGGGTCCTCACAGTCTAGTTAGGACTACTTTTATCCTGGTGTTTTTCTTCTAGCCACAGGATTATATCT

TTTATGAACATAGGAACTAAAACATTTACAAATATTAAATGGAGGTGTTCTTTGTTGTTGTTTTGGGTTTTTTTGTTTGTTTGTTTGTTTTAACATTTGT

CCCTTTTATTCACAAAAATTAAGACTTACCCCTTTGTTGAACCTCTTTTCTTTATGATTTTACACAAAGGACCTTGAGATATATCAATTATAAAACCTCA

AAAAAATCTTTAAAGTTTACAAACAGGCACTTTTTACAAGAGTTTTCTATAAAATCCATCAATGTAAAAAAGACACTGGACTAAATTTAAGGCATGTTCA

GTTGTCATTAGAATTATTTTTGTTTTGTTGGAGACTTTTCTCTCCTCTCGTCCTGACTTCTCTTTGATTCTCTAGAATGTTCAGGGCATCTGCTAGGCTT

TTCCCAGCGTCTCTTGGCACCATTCTGACACCTGTTGTCATCTCCTTTATGGTCAGAATGCTTTCAACTCCTCTCCCTTGACTTGAAGCGATCTTTTCTT

CTGACATTATCACTGTCCTGATTTTGGGTTCTGTGTTTCTCATTTTCAGAAAAAGAAATCTTTTCTCTCTCACCGCTTCTTCTTTGGCTCGCCATGCTTG

TCTTCTGGCTCTCTGTGTGAGCCTTGTTCTCAGCCATTGCCAACTCTGCTGTAACTATTCTCATGGCTTCTGTCTTCCATGTGCTCTGCTAGGGGATCTT

GCCAGTCTGTGTCTCCTGAGTTCTGAGTTCTCTGTCTTTCAGACCTTGCTCTCTCAGTCCTCCCTTCCTGGTGTCTTTGGTCCTCCCTGCCTCCTCCTAG

CCTCCTGTCACATGCCTGGTGGTCCCTGGCTAACTTATCTACTTCTTCCCCACCCCGCCCCCGGCCTTGCCTTGCCTCTTCTTTGTACCTTTAGCTGAGG

CAGATCTCTGACTGCCAGAGGAGGAGGAGGAGTCGCTTGCTTCACTGGAGGACTCTGAGCTGCTCTTGCTGCTGTTGGAATCTGAGTCAGAGGAATCGGA

TGCAGAGGAAGACTCTGAAGATGAAGATGTCAGTGCTGATTTCTTTGTTCAGCTTCTGGTTTCTGTACTACAATGACACGGGCATATTTTTTCAGATGTT

CTCAAAGTTCATCAGTCAAACCTCCGAGACATGGAAGTGAAGAAATTGATGACAAACCGGGTATTTCATGGGCTGTCTTGGGGTAACCATCCTTGAAAGA

ATGGCTGAAGCATTTCATCCTTTAACCTCGCCATTCAGTTTAGGAAGACCCATGTAGTCACACAGTTCCTGGAAGAAGATCTTGACAAAAATCCTACTAG

ATGATGTCATGTTCTCTTCACTCAGCTTTATACATTTGAGAAAACTCCATGGAAGTGAATCTGTGTATAAAAGGTGAGCAAACATCTTAGCAACATTTCT

CAATTTGTTTGTCTCTAAGCGAAGGATGGTGTAGTACTGTTCCTTGAATATACTTTCAAATGATTCCATGTATTTTTTTCAGCATACAAAACCACCCAGC

TAACAAGACAAAAATTTTTTCATAGGTCTTTTGTTGAGCACAGCAATCAAGTATCATGTTGCAGAGTTCTTTTGTTTGGCTCTCAGCAAACTCCATTTTC

AGCAACTTGTGTGCACATTCTTCAAAATCTAAACTTGACTGAATGGCAAGGTATATTTATTGTAAGGCGAAATGAGACTAGTTGATTTCTGTTTTGTTGG

ATAGTTACGTTTTGTCCTCCTTTGTCTTCTTCTTCTTCTTCTTCCTCTCCCTCCTCCTCATCTTCAATACTTACAGCTTCTTGGTCTGTGTTTGAATCAC

TGTCTCCTTCATGGGATTTTTTTTTTAATAGCCTTGTTCTTCGTCTCTTCACTTTCCATAAAATAAGGATCCATCTTGAAAACATTAAGAACATGTTCTG

GATTGTAGTCATCCTCCAAGGGGTGCATATGTATAAACTGATAGTCCTCTTCCATTAAATCAAGTCCTTCCAGAATAACAGACTGGTCCTTGAATCCATC

CTTCTGTACAACAAACATCACTTTAATCGTATAATGAACTCTTCTGTCAATCTCAGACTGCTGTAGAATGTTTCACAGGAGTCCAAAGATTGCATTGATT

CCCCTTTGTGACACGTGGATTAATTTGAGACCACACTCCTTGAGGAAGCTGATACCACTTCAACACTGTCATCTGTTGGTCTCTCTACGAGCAAAGTGAG

CATCTCCAAGCACAGAGCTTCATATGCCACATTTTGGTTAATAAGATGTGCCACAAATTTTGAAGCAGTCAGACAAATTTGCCTATCATTCTTTTGATAT

CCTTCCCAAAAATTAAGAATTAGTCTCTTGAGGATTAATTTTCCAGTCTGTGGGACTTTTGAGTTGATTATTGCCACCAAAGCTGCATAAACATGAGGGA

AGATTGGAGAAGCACTCTGCACTTGCAGAACAGGTCTGGACAGCAATCCTCTCCCTCTGACTATGTTCTCTTGAAGGAGCTCTTGAATTTTATTGGAGAT

ATTGACCTTGTTGATATGACCATTGATTGATTTCTTCAGAGCATCCCAAATTATCCTACGGTACACTAAGATGTTTTTATCTACAATCTGTTCCTGCATC

ATCCTGAGCTTTGAGGGAGGAATATGTGCTCCCCTAGTGCAGGTGAGCAGCAGCTCCTCCACCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCT

CCTTTTCCTTCTTTTCCTCCTTTTCTTCTTCAATGTAGGTTTTTCCTGTGTAGAACTCTGGGTTATTCCTTGCAGTCTGGGCTTCTTCTTTCAGGAGATG

GGGATTTCCAGGACCATTTCCGATATCTCTTTTTCTGTATTTTTCTCAATCCCTACTTCATGATTCTATGCTGTCATCATAAGAGTATCCTTTTCTAGAA

TGCTCATAGTCTGACCGGCTGTAATCAGAGTAGTCTCTGTCCCCAGGTGGGACTGTTCTTGTTCTGCCTATCTGTCTTCTGGGGAGGCACTCCAGTGGTA

TGAATTGTGGTTCTCCCTTCTGTCATGACCAGAGGACTGTTTCATGTGTGCCACACTACTTTTCATTTTCTGCTGGCAGCTGACCCAATAAACCAGATGC

CTTGGGTTCATTCAAGTGACACGTATGCAATGGTCTGAGTTCCTTGACAGTTTTTTTTTTCCTGTCTCCACATGTCACCTAAAGCTCTACCACACTTCTG

TCACACTGGAAGTGCCAAATGGTGGTGTTATATAGCCAGTCCCAAAGGAAATAGCCTTTTCAATGCAAAAACAATCTTCCTTAGCAGATTAAAAATATAG

CAATGACCTTGAAGAAGTCAAGATCAATTATTATAAACAAACAAACAAACAAACAAACTGGGACACTTGCTTAGCATGTACACAAGGCCCCAGTTCAATC

CCAAGAACTTCAATAGGAAAACCATGAAACTACTATAATGGAAACATATTTTTCATATATATGTAGTGGATTTGGTTTTGAGATTTTTTTTAAAGACCAG

GAAAAAATGATAACTACTGGCTGTTTTCATGAACATATTTGTGGCTGATAGTGAAAATCAACAAACTAGTATTTCCTTGACAATATTAAAACATATTACA

CTATCAGAAGTGTCACTCTGAGAAGCAGAGGTAAATGGAAATTTTTCCTACTTTACTGCATTTACATGCTTAACTTAGGATATCAAGGACTTTCTAATGT

ATATCTGAGAGTACTTATCTTCTAAAATGCAAGTTAAAAGCGCAACACTGAAACTACAATAACAATGAAAAAGAAGGTACCTTCCTCATTCAGTGAAGCT

AAAATTAGTTGCAAGAAATGAAAATTGCAGTTGCCCTGGAGAATAGGAAAATTAACACATGCAAAGAAAATGTTAAAAGAAAATTGGCCTGTTTAGGGAA

CCTGGGGATGTTTTGTTGTAAGGTCAGTTATCAACAGGACTTTTACACAGCAGCAGTAATCCGTGTTAGAAATGTTTGTTACTATTGGAGAAAAAAATAT

CGTGGCCCAGTCACATCCTGTGTTCTGTATATTGTTAATATCAAGACCTCAAAAGATGTCCAAGAGCTCATTTCTGCAAAGACAGAAACAGCTACTTTTA

GGGTCCTTATATTAGGGAGTCCTACCAGTTTGTAAGAGAAATGTTAAGTGGTGGATGTAAACAGACATTGATCAAAATGATTTTGTCTCCCTTTTTGTGG

AGGAGTGTTCAGCCACTTAGCCTGATTGTTTATAATCACCAACAAAATTCTGAAATTTTTAACTGCTGCCTTTTATCTGTGAGGTGGTAATGAAATACCA

GGAATGGTGTGTCCTTTTAATGAAATTTATTTTTAATCAAATCCCCCAAATTTAAAAAAAAAAGTTTTGTGCTTTGAAGTGGTACCTGTGTCACTGTTTC

TAAATGGTGACTAGATTTCTTTTTGAAGTTGTGTTTACCTTGACAGACAGCACTCTGCCATGCCCTTTGCCAAGCTATGCTTTGTAATGCTCTAATGAAA

TAGCCAACTAACTTATGACCCTACACTTGACATAAACAAGCCTTTATTAAGAACAGATTTGCCAAGGGGTGGGAAAAGAAAGGGATATTTTCATGCTAAT

ATAATTATGATTGTTCCATTAAATTGTATACTGGGTATATTTTGTTCTTCATTGAAATTTTATTTTGCATTAACTTACTGAGTAATCCCTTTTAGCAATC

CTGCATTCCATTTTACTGGTACTACCTCTGAAACATATTATCTCCTTAAAACCATATCAGATTTTAATGTGAATTTTTGTAGAGTTTTTATTTAAACTTT

TATAGAGGCAATAAATGATTTCCAACTAA
Translation
 - UNI31596 - MSSKSCESGAAGTVSGTSLAAPDITVRNVVNIARPSSQQSSWTSANNDVIVTGIYSPVSSSSKQGTTKHTNTQITEAHKIPIQKAA

NKNDTELQLHIPVQRQVAHCKNASVLLGEKTIILSRQTSVLNAGNSVYNHTKKSYGSSPVQASEMTVPQKPSVCQRPCKIEPVGIQRSYKPEHAGLASHN

LCGQKPTIRDPCCRTQNLEIREVFSLAVSDYPQRILGGNSTQKPASAEGTCLSIAMETGDAEDEYAREEELASMGAQITSYSRFYESGNSLRAENQSTNL

PGPGRNLPNSQMVNIRDLSDNVLYQTRDYHLTPRTSLHTASSTMYSNTNPSRSNFSPHFVSSNQLRLSQNQNNYQ - UNI1487 - ISGNLSVPWITG

CSRKRA LQDRTQFSDRDLATLKKYWDNGMTSLGSVCREKIEAVAIELNVDCEIVR - UNI17811 - TWIGNRRRKYRLMGIEVPPPRGGPADFSEQ

PESGSLSALTPGEEAGPEVGEDNDRNDEVSICLSEASSQE EESNELIPNETRAHKDEEHQAVSADNV KIEIIDDEESDMISNSEVEQENSLLDYK NE

EVRFIENELEIQKQKYFKLQSFVRNLILAMKADDKDQQQ ALLSDLPPELEEMDCSHASPDPDDTSLSVSSLSEKNASDSL
Transcript ENSMUST00000038472
Sequence
ATTGTCTGAGGCGGCAGTGGAGACCCAGGAAAAAATCTTGCGGACTCCGCCTGCTCTGGCCCTGGTCTCATCTTGGAACCTCTGATCTCTTTCGTGACCG

CACCACGCCCGAG - UNI31596 - ATGAATCTACGTTCTGTATTTACTGTAGAGCAACAAAGGATTTTACAGCGTTATTATGAAAATGGAATGACAA

ATCAAAGTAAAAATTGCTTTCAGCTCATATTACAGTGTGCACAGGAGACTAAGCTGGACTTCAGTGTAGTCAGG - UNI31596 - ACGTGGGTTGGC

AATAAGCGAAGAAAAATGAGTAGTAAAAGCTGTGAATCAGGAGCAGCAGGAACTGTGTCTGGTACCTCATTGGCAGCGCCAGACATTACAGTCAGAAATG

TGGTTAATATTGCCCGCCCTTCAAGCCAGCAATCTTCTTGGACTTCTGCCAATAATGATGTCATTGTAACTGGTATATACAGTCCAGTAAGCTCATCAAG

TAAGCAAGGCACTACAAAGCATACAAATACACAAATTACAGAAGCACATAAAATTCCTATTCAGAAGGCAGCCAATAAAAATGACACTGAATTACAATTG

CACATTCCTGTTCAAAGACAAGTAGCGCACTGTAAGAATGCTTCTGTGCTCCTAGGGGAAAAGACAATTATTTTGTCAAGACAGACAAGTGTACTAAATG

CTGGAAACTCAGTGTACAATCACACAAAGAAAAGCTATGGAAGTTCTCCGGTGCAAGCTTCAGAAATGACAGTACCTCAAAAGCCATCTGTGTGCCAGCG

ACCTTGCAAAATTGAACCAGTTGGGATTCAAAGGTCATATAAACCTGAACATGCAGGTCTGGCATCACATAACTTATGTGGGCAAAAGCCAACCATTAGA

GACCCTTGCTGTAGAACACAAAACTTGGAAATTCGTGAAGTGTTTTCATTGGCAGTCAGTGATTACCCTCAGAGAATTCTGGGAGGAAATAGCACACAGA

AGCCGGCCTCAGCAGAAGGAACTTGTTTGTCCATTGCAATGGAGACTGGAGACGCAGAGGATGAATATGCCAGAGAAGAAGAACTGGCATCAATGGGAGC

ACAAATAACAAGCTACTCAAGGTTTTATGAAAGTGGCAATTCCCTTCGAGCTGAGAACCAAAGTACAAATTTGCCTGGACCAGGAAGAAACCTGCCAAAT

TCACAAATGGTGAATATTAGAGATTTGTCAGACAATGTACTGTATCAGACTAGAGACTACCATTTGACACCACGGACCTCATTGCATACAGCATCTAGTA

CTATGTACAGTAATACTAATCCATCACGGAGTAATTTTTCTCCACATTTTGTATCATCAAACCAACTGAGGTTATCACAAAACCAAAACAATTACCAG -

 UNI1487 - ATTTCAGGAAACCTTTCTGTGCCTTGGATTACAGGGTGTTCTAGGAAAAGAGCA CTACAGGACCGCACTCAATTCAGTGACCGAGACT

TGGCTACTCTTAAGAAGTACTGGGACAATGGTATGACCAGCCTGGGCTCTGTATGTAGAGAGAAGATTGAAGCTGTTGCAATTGAATTAAATGTCGACTG

TGAAATAGTTCGG - UNI17811 - ACTTGGATTGGGAATCGAAGAAGAAAATACCGTTTAATGGGAATTGAAGTTCCACCTCCAAGAGGAGGCCCTG

CTGATTTCTCTGAGCAGCCTGAGTCTGGTTCTTTGTCTGCACTCACACCAGGAGAGGAAGCTGGGCCTGAAGTAGGAGAGGATAATGACAGAAATGATGA

AGTGTCCATCTGTTTGTCCGAAGCAAGCTCTCAAG AGGAGTCCAATGAACTTATCCCAAATGAGACCAGGGCACATAAGGATGAAGAGCACCAGGCAGT

ATCTGCAGATAATGTG AAAATAGAAATTATCGATGATGAAGAAAGTGACATGATAAGCAATTCTGAGGTAGAACAAGAAAATTCTCTCCTGGATTACAA

G AATGAAGAAGTCAGATTTATTGAAAATGAGCTAGAGATTCAAAAGCAAAAATACTTTAAGCTCCAGTCTTTTGTTAGAAACCTGATTCTCGCTATGAA

AGCTGATGATAAAGACCAGCAGCAG GCACTGCTGTCAGATTTACCTCCAGAATTAGAAGAGATGGATTGCAGTCATGCCTCGCCGGATCCTGATGATAC

CTCACTCAGTGTGTCTTCTTTATCAGAGAAAAATGCCTCAGACAGCTTGTGATTGGGAGTGGGGGATATGATCTAGTCTGTTGATTGCCTAACAGGTGTG

CATTTCAAGATAACTGTACTGTTTCCCAAACAGTCTTCAACTGGAAAAACACATTGTTAAAGCAAACATATGCTGTGAAGGAATGACAAGATATAGTGGC

TACAATACAAAATAAAAAGCATGTACAATACTTGAAATGGTTTGTTTTTAAAACTTATATAAAATCCTAGGAAATTGTATTTAATTTTGACCAACTCCAC

TATGAAATCTATTATATCTGATTTCTGAAAGATTTTTTTGCTTATTCTTTAAGAAGAATCTTAATTTTATCCAGAAATATAGAAAATAAGCATATCACAA

CATTACTAAGTTGGTTAGTTTTATTTTGTAGCCATTACATCTTTCTTCCTACTTCATTTTCTTATCATTCATATACATTTTTACTCAGGAAAGTGGGCTA

AAAATTTACAACAGGCCTAATCATATATTTAACCTGGATGAATCCTGGGATTTATTTTTCAATTCCGATGAGAATTTGACCTAAGATAATGATTGAAAAT

TGAAGCACTTACTAGGACGTAATTGTAAGTTATTGGTACTCCTGACACTGGGGAGAGGGAAAAATCCTCTGAAAAGTAGAATCATTGTCAAAATGTCAAA

ACATTTAAGTACATAAAAACTGTACTTTTTAAAAAACACTTTTAATCTCAATTCTTGTATACAATAAGTGATAAGTATTGATGATTAATATTCTACCATA

TAGTAAATTTATATAATTGAGTCAGACAAAATATTGCACAAATACTTCAAGTTTATCAACATTTTCATAATACTTTTCATATCTTAAAATTTGTGAAACA

GGAAATCAAAGTATGGTACTGGTATCTGTTTGTTTTTATTTAATTCTAGACATACAACTTTGCCACAAAGTTTACCTCATTTCCATATGAGGCCTGCACA

AAGCCAACAATAATGTCAAAAAAATAATTATATATAATACTTTGATTGTAAATCAAAGTCCTCTGGATCTCTTGGATGCTATTCTATGAATACACACCTA

AAATGAGCATGGTACCCAGTTGTTACTATTAGTAGGTACCAAATGGCAGCACACTGTAGACATCTTTTTGCATCTTCCCTTCTGGAATACCAGATGGTAT

TACTAAGGTCTGTCTATAGATGGAAAAATACTAGTTTCTGCCTAAACTCACAATGTCATATATTTGTAACTAGGTTGTGTGGAACTATATTACACGATTA

AATTATTATCTATTCCTGAAAGATGCATGAAGCATCTAGATAACTGTTTCAATTATCAAGTTTCAGATATGTTTAAGTTTCTTAACTACAGCTATTCTGA

TCTCAGAATTTACTGATACCAATTTATGATTCCAGAAAGGCCCTTATTAATCCCTCTAGCTCAGAAATGTCCTTTCTCATTACTATATACAAGTAAAGTT

CACTGATGACCATTCAGTTCATCAAATGTTTGATTTTACACTGTTGCCACACAACCTCTATGGCTTCCTTGTCAGCAGAAATATTTCAGTAGTCAGCTAA

TCATGTCCTTTAGCTGAAAGTCATGTGGTTCTTTGCAAACAACTTCTGGTAGTCCTTGCTGACAAACCAAATTCCATTCAGGGAAAAGACCACTGAGCCA

CAGAAGCTCAAACATCTAGATTAAGCTCTTCAGTCACATAAATTTCTCCATAAAATAAGAGTCCTCCCTACATACAACAAATACAGAAACCCTGATTATT

TTATTATATGGAGGATTAAGACAAATTTTCCTGTAGCCCAATCTGGCCTCATATTTCCAATATAGCTGAGGATGGCTTTGAGTCCTGCTGTTCCTGCCTT

TGTTTCCCAAATGCCTGGATGGCAGATGTGCCCCACCACACCTAGGTTCCGTTTGTTTGAGTAGGAACCCATTTCTGGTCTCAAGTCTCTCTGTGATCTT

CTTTAGTACCATTGAGTTTCTCTTTAAACTGCTTCAGTTTAAGACACTTCCTAGTTGGTTTTCATTACAGAACAAATGAAAACAACAAAAAATTATTTTC

ACATCTTAGAAATGTGTTACT
Translation
 - UNI31596 - MNLRSVFTVEQQRILQRYYENGMTNQSKNCFQLILQCAQETKLDFSVVR - UNI31596 - TWVGNKRRKMSSKSCESGAAGTV

SGTSLAAPDITVRNVVNIARPSSQQSSWTSANNDVIVTGIYSPVSSSSKQGTTKHTNTQITEAHKIPIQKAANKNDTELQLHIPVQRQVAHCKNASVLLG

EKTIILSRQTSVLNAGNSVYNHTKKSYGSSPVQASEMTVPQKPSVCQRPCKIEPVGIQRSYKPEHAGLASHNLCGQKPTIRDPCCRTQNLEIREVFSLAV

SDYPQRILGGNSTQKPASAEGTCLSIAMETGDAEDEYAREEELASMGAQITSYSRFYESGNSLRAENQSTNLPGPGRNLPNSQMVNIRDLSDNVLYQTRD

YHLTPRTSLHTASSTMYSNTNPSRSNFSPHFVSSNQLRLSQNQNNYQ - UNI1487 - ISGNLSVPWITGCSRKRA LQDRTQFSDRDLATLKKYWDN

GMTSLGSVCREKIEAVAIELNVDCEIVR - UNI17811 - TWIGNRRRKYRLMGIEVPPPRGGPADFSEQPESGSLSALTPGEEAGPEVGEDNDRNDE

VSICLSEASSQE EESNELIPNETRAHKDEEHQAVSADNV KIEIIDDEESDMISNSEVEQENSLLDYK NEEVRFIENELEIQKQKYFKLQSFVRNLIL

AMKADDKDQQQ ALLSDLPPELEEMDCSHASPDPDDTSLSVSSLSEKNASDSL

For any suggestions or comments, please send an email to unitrap@crg.es