Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034555 (Tex16)
Chromosomal location
Chr X: 109207129 - 109240935 (+)
Description
testis expressed gene 16 Gene [Source:MGI Symbol;Acc:MGI:1890545]
RefSeq_dna
NM_031382 
RefSeq_peptide
NP_113559.2 
UniGene
Mm.190608 
MGI
MGI:1890545 
Uniprot/SPTREMBL
A2RT18 Q99MW8 
Human Ortholog
not available
Omim not available
UniTrap UNI33089
Vector Insertion
Chr X: 109207985 - 109211756
Public Clones IST14290H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000038546
Sequence
CAAAGTCTGATGGAATCTGAAAAAACAAAGATGGAGAGTGAAAGTTTGTGGATGATCTCTGATTCTGAGAGTTATTCAGTGGACTCACACACAGAAAAAG

GTAGAGCATCAGTATCTAAAATAAATCTGATACAAATTGATGAAACAGAAAAACCAAGAACTAAGAGATACTTGATGGAGTCTGATTCTGAACCAAGTAA

TACAGACTCAGATTCAGAAGGATGTGAGCTAGCCTCAGCAGCTGTGAAATACTTCATAGCTACAAAGACATTTCAGCAGAGCAGTGCTAGCAGCCAGTTC

CCAAAGGATTCATGGTCTGCAAGTAGAACAATAAACTCAGACTCTGAAAGCCCTGTGATGTCCTCTGATTCTATGAAATACATGAAGAAAGCTGAAACAT

GCAAGAGTACCTGTAATTTGGAAAGACTCAAGGCGGCTCACAAGTCTGAGTCTCTACAGGACTGGTTAGATGCTAAAAGAAAACAATTAGATTCTGATAA

TGCTGGATACTGGGATAGCTCTGGAAAATATCAGTTTAGTTCTATAGTACCTCAAGAGAGCGTTGGAAAACGTCAGGGTGACCTTCAAACGTTTCAGCAT

AGCACTGAAAAAAAGGAAGTAGGATCCAGTTCTGATAAACATCAGGCACAATTTGGAAATGAAAGAGATCAAAGTGATCCTAAAAGTAAAAGATACCTCA

TAAAGACAGAGACGGGATTAGACAATGAGGGGTTTCAAATGGATGAGGAAAGAGAAGGATGTCTTGTGGAATCTGACTTTCGTGATTCAGAACGTGAGGC

ACACCTGCTAGAAGCCCACCGGCTTGGTGCTCGTAAAAAGGAGAATCGTCCTCCAG - UNI33089 - GGTTTTGGAGACCCATTATCCTGCCTCCTA

AGCTTGCCCAGGATAAGAAAACTGAAGAACAAAAGTCTGTACAGCAAAAGGATAACAGAG TTTCTAGAATTCAGCTAACAAGATACAAGAGTGAAGACA

AAAATGTGAGATTCGAAGAGGCATCTTCAAGTCTCAGTGACAAGCCACTCTCGCAAGAAAAGTTAAAGAAAAAGCACAGCTATAGCTTTTCTCCAGACTC

TCCCACATTCACAGATGAAAAGCATCACAGAAAAGCTAGCCTGAAAATATCTGGCTATAAGCGCCAGTGCAAGGAATATAGATATCCCCATAGTTGTGAA

AGTTTGAAGTATCAAATCAGTCCCATTCCCCTAAGTTCTGAGACTTGCACCTCTAATGTATCATCATTTGTTGACAGCCCAACTTCTAAAAGTCCTAAGT

CTGTCACAAGAAAGAAGTCTCGAAGAAGTATTACATATTCTCCAGAACAGGGAAGTCAAAAATGTACTAGATGTTTTATGGAAATCAGTAACTCATCTTA

TCATAAATGCCTCATAAATTCTGATGATTCTGACTCAGACTCTCCATTACATGGCCAGATTTCCTCACATTCTAAATATTCTCTGCGCTCTAAAACTATC

AGACACTTCAAGACTTCTCGAAATCGCCCTTTATCTCAATCCCTGGATCCTCAGCATTCTGTGGTCAGCCGCTGTTCTCTGCACAGGGAAGATTCTAAAC

ATTCTATAGATTCCACCTCTTATTTACATTGTGAAAGTTGTGCATCTCTTCAAAACCTTAAGGGCTCTTCTGTTACACACACCATTTCTAAGACCACTAA

GAAAATCATGGGCCAACATAGTACCCATGGCCACATATCAGGACCTGTAAGATTGTCTCAAAGTGAAAGCAAGTTCAACCTTACTGCTCAACCTCAAAAT

GAGGATACTCCTGATGTCAGTGATAGAAATATCAAAGCTGAGGCTAATGTTGAAGATAAACTTCTTTACAAAGATGATACAGACCATGAAGATGAGACAA

ATACTGAAGATGAAACGGATGGTGAAGATGAAACAGACACTGAAGATGAAGATGAAGATGATACCAAAGATAAAAAAGATCCTAAAGACAAATCTGACCC

TGATGGCAGTGATCCCAAAGATGGCAACTCTGAAAATAATACTGATAGCAACAATGGGTCTCAACCTAGTGGTTCTTCTGGACCTACAGGTGGACCTGAT

TCCAGCAATGATGGTGACTCTAAAAATGTAACTGATCACAAGAGTGAATCTGACCCTACCATTGATAACGCTACCAACAGTGATGTTAACTTGAAATATA

GCACTGATGAGACATGTACCAACAATTTAGACAATGCTTCAGATCTGGCAGAATATTTCAATCATCACAATAATGCTGACTTCAAGGGTCGCACAAACCC

AGCCTCTGGAAACAAAACTAGAACCATACTGGACTATATTTCTGGTTCCAACAATGAGGACACTGGCCCTAGAAATACGATGATAAAAGAAAAAATTGCT

TATTCTGAGAATATTAGATTGCTTTCCAACAGTTATCAAAATAATGTCATTAAAAATGGGAGTGAACCAAGCAGCAACCCAAGCCCCCAAAACAGCTATG

GGCTCCCAAAAGACCTTGACTCTAACTCTAATATCAATCCCAGTAATGCTACTAACAATACTGTTAACCCTAACTATGGTGCAAAATCCACGAGCACTGC

TATTTACAAAAAGACAGCTGCCCTAAACTATTATTCAGATATTAATGATGTCACAGGGTTTACATATGAAGTAAGGTCAAGTTTTGTAGTCAACTCAAAC

TATTTTGACAGAAAGAAATATGCTGGTAGACTCAGCTTTGCACTTCACACTATCAATGCCATTGATACAAATAATGTTATCACCTGTACTAGTGCTGTTA

GGTCTAAGTTTGCTTCTGAAAAAACCTCTGTCCTAGACACTAAACATTCCCCTAGATTTAGTCGTTTCAGGAGTTTCAATGTTATCATCAGCCCAAATTA

TAATACTAAAAATAGTCAGAATGCTAATAAATCCAGTATCAGCAATATTTACAACCTACCTGCCACTGAATTAGAAATAAATATATTATCTGTTCTTAAA

ATCATTTATGGAAATACCCCAAATTTTATTGCTGGAACAAACTATCCTGATTTTTTGATAACCTCGGAATTTTATGAACCACTTAAGCTTTGTAGAGCTT

ATAAAATTTTTGATAACCAAAATATTGATGCTCCATTCCAAGACTCTGCTGGATACATGGACTCTCATAATTCTACATATGCCACTGGGTCCATGGTTGC

CCTTGATGCCAAAGAATCTGGCTTTTTAAAATATTTTCCTAGGATCCAGAATACAATTGGCATCAAGGATCCTTCTTGCCCTTTCAAGGTGTTTTCAAAT

CAAAATATTCTAGTCCCTAGTTTCGATGTTATAGTGGAAGCTGAACTGCCAGATATTATGAAGTTTACTATATCATCAGGTGCTGTGAATCAATTATTTC

AG CTCAGACTCCAAACAGGTAGCAGACAAAATGTTGACCTTTGATTAATGAAAAGAATACCTTGGGATGGAAAAGACAAAAGCACAACCAAGAAGGTTC

TGAGGAGATGAGCAAATAACTTCAAAAGAACTACAGTGTTCCCTGAACAATGTTTATTTTATGTTTATTCTTAGATATTCACCCCATTATATGTCCATGT

TTTTATTGTCTATTGTGGCCACAAATACTTCAAAGTACCATGTGACAATTGCCCCTTCCATATGATTTACATGTGGCAGAGTATGGAATTAGGAAAAGGA

CACACTGTAGTCCTTTTCTAGACAGCATCCAAAAATAAATTTTACTACTATATATTCATAATATAGATGAGCTTTTCAAGCAAATTCTTCCTTGTATTAT

TCTCTGTATTTTGAAGAAGAGGGCTTTAACTTTAAAAAAATTTAAGACAGATAAAATTTTTTTTTAGTATTGTGGAGACAATTCTAGATTTAAAAGAACC

CATACTAAATCTATAATTTATTGTTAATCTTAATTGTTGTTACTGTTTTGTGAGTGTGGAGCTCGAAATTAAAATAGTTAAGACTCAT
Translation
MESEKTKMESESLWMISDSESYSVDSHTEKGRASVSKINLIQIDETEKPRTKRYLMESDSEPSNTDSDSEGCELASAAVKYFIATKTFQQSSASSQFPKD

SWSASRTINSDSESPVMSSDSMKYMKKAETCKSTCNLERLKAAHKSESLQDWLDAKRKQLDSDNAGYWDSSGKYQFSSIVPQESVGKRQGDLQTFQHSTE

KKEVGSSSDKHQAQFGNERDQSDPKSKRYLIKTETGLDNEGFQMDEEREGCLVESDFRDSEREAHLLEAHRLGARKKENRPPG - UNI33089 - GFW

RPIILPPKLAQDKKTEEQKSVQQKDNRV VSRIQLTRYKSEDKNVRFEEASSSLSDKPLSQEKLKKKHSYSFSPDSPTFTDEKHHRKASLKISGYKRQCK

EYRYPHSCESLKYQISPIPLSSETCTSNVSSFVDSPTSKSPKSVTRKKSRRSITYSPEQGSQKCTRCFMEISNSSYHKCLINSDDSDSDSPLHGQISSHS

KYSLRSKTIRHFKTSRNRPLSQSLDPQHSVVSRCSLHREDSKHSIDSTSYLHCESCASLQNLKGSSVTHTISKTTKKIMGQHSTHGHISGPVRLSQSESK

FNLTAQPQNEDTPDVSDRNIKAEANVEDKLLYKDDTDHEDETNTEDETDGEDETDTEDEDEDDTKDKKDPKDKSDPDGSDPKDGNSENNTDSNNGSQPSG

SSGPTGGPDSSNDGDSKNVTDHKSESDPTIDNATNSDVNLKYSTDETCTNNLDNASDLAEYFNHHNNADFKGRTNPASGNKTRTILDYISGSNNEDTGPR

NTMIKEKIAYSENIRLLSNSYQNNVIKNGSEPSSNPSPQNSYGLPKDLDSNSNINPSNATNNTVNPNYGAKSTSTAIYKKTAALNYYSDINDVTGFTYEV

RSSFVVNSNYFDRKKYAGRLSFALHTINAIDTNNVITCTSAVRSKFASEKTSVLDTKHSPRFSRFRSFNVIISPNYNTKNSQNANKSSISNIYNLPATEL

EINILSVLKIIYGNTPNFIAGTNYPDFLITSEFYEPLKLCRAYKIFDNQNIDAPFQDSAGYMDSHNSTYATGSMVALDAKESGFLKYFPRIQNTIGIKDP

SCPFKVFSNQNILVPSFDVIVEAELPDIMKFTISSGAVNQLFQ LRLQTGSRQNVDL

For any suggestions or comments, please send an email to unitrap@crg.es