Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034557 (Zfyve9)
Chromosomal location
Chr 4: 108310071 - 108453403 (-)
Description
zinc finger, FYVE domain containing 9 Gene [Source:MGI (curated);Acc:Zfyve9-001]
RefSeq_dna
NM_183300 
RefSeq_peptide
NP_899123.2 
MGI
MGI:2652838 
Uniprot/SPTREMBL
A0S860 Q6PDX5 Q80XL0 A8Y5G5 A2A8R0 
Human Ortholog
ENSG00000157077 (ZFYVE9)
Omim not available
UniTrap UNI34449
Vector Insertion
Chr 4: 108400060 - 108453109
Public Clones IST14990A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36262
Vector Insertion
Chr 4: 108396411 - 108400151
Public Clones IST13485F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35120
Vector Insertion
Chr 4: 108368373 - 108392418
Public Clones IST14997A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 52% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20101
Vector Insertion
Chr 4: 108357637 - 108361753
Public Clones not available
Private Clones OST372966 (lexicon) OST361368 (lexicon) OST356405 (lexicon) OST24562 (lexicon)
OST19150 (lexicon) OST10391 (lexicon)
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28024
Vector Insertion
Chr 4: 108333321 - 108347057
Public Clones not available
Private Clones OST42159 (lexicon)
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000042185
Sequence
ATGGAGAATTACTTCCAAGCAGAGGCTTACAACCTGGACAAGGTATTAGATGAATTTGAACAAAATGAAG - UNI35120 - - UNI36262 - GTT

TTCTGTGCTTCCTGCTGCAGCCTAAAATGCAAACTGCTGTACATGGACAGAAAGGAAGCCAGAGTGTGTGTAATCTGTCACTCAGTGCTGATGAATG - 

UNI35120 - CTCAAGCCTGGGAGAACATGATGAGTGCCTCAAGCCAGAGCCCTAACCCTAACAATCCTGCTGAATACTGTTCTACTATCCCTCCCTTG

CAGCAAGCTCAGGCCTCAGGAGCCCTGAGCTCTCCACCTCCCACTGTGATGGTACCTGTGGGAGTTTTAAAGCACCCTGGAACAGAAG TGCCTCAGCCC

AGAGAGCAGAGGAGAGTTTGGTTTGCTGATGGGATCTTACCTAATGGAGAAGTTGCTGATGCAGCCAAATTAACAATGAATGGAACTTCCTCTGCAGGAA

CTCTGGCTGTGTCACATGACCCAGTCAAGCCTGTAGCCACCAGTCCTCTTCCAACAGAG GCTGATACTTCTCTGTTCTCTGGGAGCATTACTCAGGTTG

GAAGTCCTGTTGGAAGTGCAATGAACCTTATTCCTGAAGATGGCCTTCCTCCCATCCTCATCTCCACTGGTGTGAAAGGAG - UNI20101 - ATTAT

GCTGTGGAAGAGAAACCATCACAGATTTCAGTCATGCAGCAACTGGAGGATGGTGGCCCTGACCCACTTGTCTTTGTTTTAAATGCAAATTTATTGTCAA

TGGTTAAAATTGTAAATT ATGTGAACAGGAAGTGCTGGTGTTTTACAACCAAAGGGATGCATGCCGTGGGTCAATCTGAGATAGTTATTCTTCTGCAGT

GTCTGCCAGATGAGAAATGTTTGCCTAAGGACATCTTTAATCACTTTGTACAGCTTTACCGGGACGCCCTGGCAG GGAATGTTGTGGGCAGCCTGGGAC

ATTCTTTCTTCAGTCAAAGTTTCCTGGGCAGTAAAGAACATGGTGGGTTCTTGTATGTGACATCTACCTACCAGTCACTGCAAGACCTGGTGCTTCCAAC

CCCTCCTTACCTGTTTGGGATTCTCATCCAGAAATGGGAAACTCCTTGGGCCAAAGTGTTTCCCATACGACTCTTGTTAAGACTTGGAGCTGAATATCGA

C TTTACCCCTGTCCACTGTTCAGTGTCAGATTTCGGAAGCCATTATTTGGAGAGACTGGCCATACCATCATGAATCTTCTAGCA GACTTCCGAAATTA

CCAGTATACTCTGCCAGTTGTCCAAGGTTTAGTGGTTGATATGGAAGTTCGAAAAACAAGCATCAAAATTCCCAGCAACAGATATAATGAG - UNI280

24 - ATGATGAAAGCCATGAACAAATCCAATGAACATGTACTGGCAGGAGGTGCCTGCTTCAATGAAAAGGCAGATTCTCATCTTGTGTGTGTACAGAA

CGATGATGGAAACTATCAAACCCAGGCCATCAGTATTCACAATCAGCCCAGGAAAG TGACTGGCGCCAGTTTCTTTGTGTTCAGTGGCGCACTGAAATC

CTCTTCAGGATACCTTGCCAAGTCCAGTATTGTAGAAG ATGGAGTCATGGTCCAGATCACTGCGGAGAACATGGACTCCTTGAGGCAGGCACTGCGGGA

GATGAAGGACTTTACCATCACTTGTGGGAAGGCGGATGCAGAGGACCCCCAGGAACAGATCCACATCCAGTGGGTGGACGATGACAAGACAGTTAACAAA

GG TGTGGTGAGTCCTATAGATGGGAAGTCTATGGAATCTATAACAAACGTGAAAATATTCCATGGGTCAGAGTATAAAGCAAACGGAAAAGTCATCAGA

TGGACAGAG GTGTTTTTCCTGGAAAACGATGACCACCATAACTGCCTGAGTGACCCTGCAGATCACAGCAGACTGACTGAGCATGTCGCCAAGGCATTC

TGCCTCGCCCTCTGCCCCCACCTGAAGCTTTTAAAAGAAGATGGAATGACAAAACTGGGACTCCGTGTGACGCTTGACTCAGATCAG GTTGGCTATCAA

GCAGGGAGCAATGGCCAGCCCCTTCCCTCGCAGTACATGAACGATCTGGACAGTGCCTTGGTGCCTGTCATTCATGGAGGAGCCTGCCAGCTCAGTGAAG

GCCCTGTCGTCATGGAACTCATCTTTTATATTCTGGAAAACATCGCATAG
Translation
MNLNKMK - UNI35120 - - UNI36262 - VFCASCCSLKCKLLYMDRKEARVCVICHSVLMNA - UNI35120 - AQAWENMMSASSQSPNPN

NPAEYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGTEV VPQPREQRRVWFADGILPNGEVADAAKLTMNGTSSAGTLAVSHDPVKPVATSPLPTE

 ADTSLFSGSITQVGSPVGSAMNLIPEDGLPPILISTGVKGD - UNI20101 - DYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNY Y

VNRKCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAG GNVVGSLGHSFFSQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLF

GILIQKWETPWAKVFPIRLLLRLGAEYRL LYPCPLFSVRFRKPLFGETGHTIMNLLA DFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNE - UNI

28024 - MMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKV VTGASFFVFSGALKSSSGYLAKSSIVED DGVMVQITAEN

MDSLRQALREMKDFTITCGKADAEDPQEQIHIQWVDDDKTVNKG GVVSPIDGKSMESITNVKIFHGSEYKANGKVIRWTE VFFLENDDHHNCLSDPAD

HSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQ VGYQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIA
Transcript ENSMUST00000106658
Sequence
CTGAGGACGAGGCTCTCGGCTGAGTGACGACCCCCGGGCCATGGAGAGGCG - UNI34449 - - UNI36262 - GATCAAAGAAGACATTCTGGGT

CAACAGTCCTGGCCAGCGGCACAGCAGGCATCATGAGCAAGCACAGAGAAGACTGCTTAAGGGGACAG - UNI34449 - - UNI36262 - GACTA

GCTAAGTCTCTTCAGCAGTGTTCCCTCACTGATGGAGAATTACTTCCAAGCAGAGGCTTACAACCTGGACAAGGTATTAGATGAATTTGAACAAAATGAA

G - UNI35120 - - UNI36262 - ATGAAACAGTTTCTCCTACTTTATTGGATACAAAGTGGAATAAGATTTTAGATCCCTCTTCTCACCCATTGT

CTTTTAACCCTGCATTAGCCAGTGTGAATGAACCTACAGTTTCTGAGACAGGACCACAGCTGAAAGTCTTCTCTCTGGCTGGCTCAGCTCCCCTTACAAA

GGAGGACAAAGATCCCTGTGCTAACGGACAGGACTGTAGTCTAAATCCAGAGACTGACACCATGTGGATTGATGAAAATGCTGTGACAGAAGACCAACTA

ATTAAGAGAAACTATAATCAGGATGATCAATTTAGTGCCGTTGAAGTGGGAGAGGAGAAATGTGGAAGCCTCACTTGTCTGCCAGACGAGAAGAATGTTC

TGGTTGTAGCTGTCATGCATAACTGCGATAAAAGGACATTGCAAAGCGATTTGCAGGATTGTAATAATTACAATAGTCAATCCCTCATGAATTCTTTTAG

TTGTTCACTGGATAATGAGACTAGACAAACTGATCAATTTAGTTTTAGTATGAATGGGTCCACGGAAAAAGGTATAAACTCGGAGAAACAAATGGATGCT

TTGAATAAACCAAAACCAGAGAGGGATTCTGTGAATCATCTCTGTGCGGCTTCATCTAACAGTGCAACCAGTATCTCTTCCCCTTCACAATTGAAGGACG

GTGAGAATGTGGGTAGAGACCCATCTACATCTACAGTTACAAGCTTAGCAGTTAATTCATCCCAGGGAATGGATGGAGGGCCTGCCATTAAACAGCAAGG

AAATTATATGCCAGATGAGGATCTTTCTGGCATGAACAGCTCTTCCAGGACAGACCTAGGGATCTCCAACTCCTTTTCCCACTCAAGTGGAGAGCTCTTA

ATAAAAACAGAGCCAGCTGAGGAGAGGACAGCTGAAGACTCCCTCCCATCTGATTTATCTTTGAATCTCAAGCCGGATACTCCTGCTTTATCTGGAAGGG

ACAATTGCGAACAGTCTTCAGACTGCCTTGGGTCTAGTGAAACTAGAGCTGATGAAGATGAAGGTAATGACTCTCAGATGACTAATTGGAAATTAACGAA

GCTAAATGAGATGAGTGATAGCCAAGTGAATGAAGAAAATCAAATGGCTTTACAGAGTAATCAACCTGAGGACACTAATAGTGGAGGCGAGTGTGTTGGA

ATGGCAGATTCTGATCTAGATTTCAAAGGAACTTGCATGAATGAGAGTGAAGGATATGATTTCTCCACTGTTAATGATGCACCAGCAGCAAATTCTCTAT

CTAATAGTTGTGATTCCTATGGAATGCAGAGCCCAATTGTATCTTTTGTTCCAAAGACATTACCCTCCAAAGAAGATTCAGTAACAGAAGAAAAAGAAAT

AGAAGAGAGCAAGTCAGAATGCTATTCAAATATTTATGAACAGAGAGGAAACGAGAATGCAGAAGGGAGTGGACTGCTTTTAAACAGCACTGGGAATGTA

ATGAAGAAAAATTATTTACATAATTTCTGTAGTCAAATCCCATCAGTACTTGGGCAATCTTCCCCCAAGATAGCAAACCTGCAATCTATTAGTGTTCCTT

TTGGTGGTGCAAGACCCAAGCAACCTTCTAATCTTAAACTTCAGATTCCAAAGCCATTATCAGACCATTTACAAAATGACCTTCCTGCAAACAATGGAAA

TAATAGTAAAAACAAAAATGATGTTCTTGGGAAAGCAAAGCTAGGGGAGAACTCAGCAGTCAACGCATGCAGTGCGACTCTGGGAAACATCTCTGTAACT

GATACAAATGGGGAACATTTAGAAACTTATGAGGCTGAGATCTCCAGTAGACCATGCCTTGCACTAGCTCCAGATAGTCCAGATAATGATCTCCGAGCTA

GTCAGTTTGGAATTTCTGCAAGAAAGCCATTTACCACCCTAGGTGAGGTGGCACCAGTATGGGTACCAGATTCCCAGGCTCCAAACTGCATGAAGTGTGA

AGCTCGGTTTACATTCACCAAAAGGAGGCATCACTGCAGAGCGTGTGGGAAG - UNI35120 - GTTTTCTGTGCTTCCTGCTGCAGCCTAAAATGCA

AACTGCTGTACATGGACAGAAAGGAAGCCAGAGTGTGTGTAATCTGTCACTCAGTGCTGATGAATG - UNI35120 - TGCCTCAGCCCAGAGAGCAG

AGGAGAGTTTGGTTTGCTGATGGGATCTTACCTAATGGAGAAGTTGCTGATGCAGCCAAATTAACAATGAATGGAACTTCCTCTGCAGGAACTCTGGCTG

TGTCACATGACCCAGTCAAGCCTGTAGCCACCAGTCCTCTTCCAACAGAG GCTGATACTTCTCTGTTCTCTGGGAGCATTACTCAGGTTGGAAGTCCTG

TTGGAAGTGCAATGAACCTTATTCCTGAAGATGGCCTTCCTCCCATCCTCATCTCCACTGGTGTGAAAGGAG - UNI20101 - ATTATGCTGTGGAA

GAGAAACCATCACAGATTTCAGTCATGCAGCAACTGGAGGATGGTGGCCCTGACCCACTTGTCTTTGTTTTAAATGCAAATTTATTGTCAATGGTTAAAA

TTGTAAATT ATGTGAACAGGAAGTGCTGGTGTTTTACAACCAAAGGGATGCATGCCGTGGGTCAATCTGAGATAGTTATTCTTCTGCAGTGTCTGCCAG

ATGAGAAATGTTTGCCTAAGGACATCTTTAATCACTTTGTACAGCTTTACCGGGACGCCCTGGCAG GGAATGTTGTGGGCAGCCTGGGACATTCTTTCT

TCAGTCAAAGTTTCCTGGGCAGTAAAGAACATGGTGGGTTCTTGTATGTGACATCTACCTACCAGTCACTGCAAGACCTGGTGCTTCCAACCCCTCCTTA

CCTGTTTGGGATTCTCATCCAGAAATGGGAAACTCCTTGGGCCAAAGTGTTTCCCATACGACTCTTGTTAAGACTTGGAGCTGAATATCGAC TTTACCC

CTGTCCACTGTTCAGTGTCAGATTTCGGAAGCCATTATTTGGAGAGACTGGCCATACCATCATGAATCTTCTAGCA GACTTCCGAAATTACCAGTATAC

TCTGCCAGTTGTCCAAGGTTTAGTGGTTGATATGGAAGTTCGAAAAACAAGCATCAAAATTCCCAGCAACAGATATAATGAG - UNI28024 - ATGA

TGAAAGCCATGAACAAATCCAATGAACATGTACTGGCAGGAGGTGCCTGCTTCAATGAAAAGGCAGATTCTCATCTTGTGTGTGTACAGAACGATGATGG

AAACTATCAAACCCAGGCCATCAGTATTCACAATCAGCCCAGGAAAG TGACTGGCGCCAGTTTCTTTGTGTTCAGTGGCGCACTGAAATCCTCTTCAGG

ATACCTTGCCAAGTCCAGTATTGTAGAAG ATGGAGTCATGGTCCAGATCACTGCGGAGAACATGGACTCCTTGAGGCAGGCACTGCGGGAGATGAAGGA

CTTTACCATCACTTGTGGGAAGGCGGATGCAGAGGACCCCCAGGAACAGATCCACATCCAGTGGGTGGACGATGACAAGACAGTTAACAAAGG TGTGGT

GAGTCCTATAGATGGGAAGTCTATGGAATCTATAACAAACGTGAAAATATTCCATGGGTCAGAGTATAAAGCAAACGGAAAAGTCATCAGATGGACAGAG

 GTGTTTTTCCTGGAAAACGATGACCACCATAACTGCCTGAGTGACCCTGCAGATCACAGCAGACTGACTGAGCATGTCGCCAAGGCATTCTGCCTCGCC

CTCTGCCCCCACCTGAAGCTTTTAAAAGAAGATGGAATGACAAAACTGGGACTCCGTGTGACGCTTGACTCAGATCAG GTTGGCTATCAAGCAGGGAGC

AATGGCCAGCCCCTTCCCTCGCAGTACATGAACGATCTGGACAGTGCCTTGGTGCCTGTCATTCATGGAGGAGCCTGCCAGCTCAGTGAAGGCCCTGTCG

TCATGGAACTCATCTTTTATATTCTGGAAAACATCGCATAGATGAGGACTCCATTGTTTCTGTTCAGACCTGTTGCAGCAGCAGTCATATCCAAATCATT

TGCACTTTAAAACTGGAAGATTAAGCTTTTTGTTAACACTGTCAGTAGGGAGGGTTTGGGGTGGGAATAGGACTTAGGGGAGATGGGGTGGGGAGGGTGG

TAGGGGACAGATGTTCCATGATTCTAAGTCTTCTATGCATTCTCCAAGAAGACCCGGGCAGCTTCTTACTGCACAACAGATATGCTATCTTTGCAGCTAA

CTCCCTTCTGTTACTGTCTAGACAAGACTTCTGCTCCTCTCTTATGATTACTTCCGGTCATGTGCTCAGATGAATGCTCATATGGGCACAACCATCACCA

AGGTCACAATGGGGGGCAGAAAGGAAATAAACAATGAATCGTCACTTTTGTACTTCCTGTACAGAACTGGCATAAAAAGACCGCTATGCTGATCATCCTG

GTTGCACCCCCAGCTGTTTGTCATGTTTAGATTCGTGTTTATTTGTTCAGATTACTAACTGAATCAAACCAAAGGGGTTTCTGGTCTGTTAGCCAGGGAA

GGTAACTCAGTATAAACCAGGGCATTTGGATAGAGAAGCTGAGTGACAGCTGGCAATGGGCACCCAGGGCATTGTTATTTACTACACACTAGAAGTATTT

TTAAAGAACATTTTACTAAGAAATCTCTTAAACTCCAGGAAAGTTGTACATGAAAAAAAAAAACAAGGCGTCTTTTCTACAGCCCCACGGACACACGCTC

ACAGGGACGCATACACACACACACACGGACGCACACGCTCACACACTAGCACTTTGCCCCTTTGGTTCGTCAGTGCTTGTCTTCCCCTCCTCTATTAAAC

TGAGGTATTTCAGATTAAGGTGCATACAGTACAGCCCCTCATCCTTAAGTCAAGTCACAGTGTCTGGAGGCTCTAACCTCATACCTGCCCAGAACCTTTG

GGAACCTTTCTTCAACAGAGAACTTTCCAGTTTAGTATCAGACGCTGCACATAGCTTTAAGCTTGTCTTTATCTCTTTGTGGCATGGAATTTTTTTTTTT

TTTTTTGGGCCCTCACATCCTGGATTTTTGTTTGGTTTTAGTAGAAAATACCTCATTTGAGTTTGGATTATTGGCCAGAAACACTTGATATCCATCTGCC

TTTCAGAGACAGTGGCAAAGCTCATTATCACCAGTACACCATGTCCAGTTTCCCAACTATGTATTTACCCTTTTAGTAATAACTAATATATGCAGAACTT

TTCAATCTATGCAAAGATCTTGCTCCTCAAAATTCCCCTTCGGTTTAGCACCACTGATGTTTTCTTGCCTGCACTGCTCTTTCACTATGACAGCTGTAAA

ATGACTTTCTAGTTTCAGCATGGCCCTTTCTTTATGAGCTGGATTTAATAGACTCAAAACAAATAAGCCCCTCCTTCCTTTGTCCTTTATTCATGGAGTT

TTCTTGTTGGTCCTGTGGACTTCTACGGTCTTAGTCTTGTACTCGGGTGATGTCTTCTTTGGTTAATTTGAACACCTTCAAGCTGGCTCCTGCATCCTTT

TCAAGGTATACTTAGGTTTAATCCTTCCTGTGTCGCCTAACAAGAAGCCCCAGGCTAATCTTGCACTTACCCTGCTCACTTTATCTCCAGGCAGCCCTTT

AACTGGAGTACAGGAAACAAAGATCTGGTTCACCGAAGATATATGTGATACTGACTGGCTGGCCTGGAGCTCAGAGATCTGCCTGCCTCTGCCTCCCAAG

CGCTGGGATTAAAGTTGTGTGCCATTACACTCAA
Translation
 - UNI34449 - - UNI36262 -  - UNI34449 - - UNI36262 - MENYFQAEAYNLDKVLDEFEQNED - UNI35120 - - UNI362

62 - DETVSPTLLDTKWNKILDPSSHPLSFNPALASVNEPTVSETGPQLKVFSLAGSAPLTKEDKDPCANGQDCSLNPETDTMWIDENAVTEDQLIKRN

YNQDDQFSAVEVGEEKCGSLTCLPDEKNVLVVAVMHNCDKRTLQSDLQDCNNYNSQSLMNSFSCSLDNETRQTDQFSFSMNGSTEKGINSEKQMDALNKP

KPERDSVNHLCAASSNSATSISSPSQLKDGENVGRDPSTSTVTSLAVNSSQGMDGGPAIKQQGNYMPDEDLSGMNSSSRTDLGISNSFSHSSGELLIKTE

PAEERTAEDSLPSDLSLNLKPDTPALSGRDNCEQSSDCLGSSETRADEDEGNDSQMTNWKLTKLNEMSDSQVNEENQMALQSNQPEDTNSGGECVGMADS

DLDFKGTCMNESEGYDFSTVNDAPAANSLSNSCDSYGMQSPIVSFVPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNENAEGSGLLLNSTGNVMKKN

YLHNFCSQIPSVLGQSSPKIANLQSISVPFGGARPKQPSNLKLQIPKPLSDHLQNDLPANNGNNSKNKNDVLGKAKLGENSAVNACSATLGNISVTDTNG

EHLETYEAEISSRPCLALAPDSPDNDLRASQFGISARKPFTTLGEVAPVWVPDSQAPNCMKCEARFTFTKRRHHCRACGK - UNI35120 - VFCASC

CSLKCKLLYMDRKEARVCVICHSVLMNV - UNI35120 - VPQPREQRRVWFADGILPNGEVADAAKLTMNGTSSAGTLAVSHDPVKPVATSPLPTE 

ADTSLFSGSITQVGSPVGSAMNLIPEDGLPPILISTGVKGD - UNI20101 - DYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNY YV

NRKCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAG GNVVGSLGHSFFSQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLFG

ILIQKWETPWAKVFPIRLLLRLGAEYRL LYPCPLFSVRFRKPLFGETGHTIMNLLA DFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNE - UNI2

8024 - MMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKV VTGASFFVFSGALKSSSGYLAKSSIVED DGVMVQITAENM

DSLRQALREMKDFTITCGKADAEDPQEQIHIQWVDDDKTVNKG GVVSPIDGKSMESITNVKIFHGSEYKANGKVIRWTE VFFLENDDHHNCLSDPADH

SRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQ VGYQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIA
Transcript ENSMUST00000106657
Sequence
CGGCCGCCGCAGTCCCGGCGCCGTAGCGGGACGTGGGGTCCAGGGGGCGCTGTGGCCCAGCGGCGCGGGCGGCTGAAGCGGCCACCGCGGCGGCGCCCGA

GGCTTCGCCGAGCCCGTCTGCCTGCATCGCCTCGGTTGTCCCGCCGTAAGCTGCGCCCCCGGCCGCGCTCGGCCGCGCTCGGCCGCGCTTTCCCGGACCC

GCGTGGCTGAGGCGGCTGGAGGGGCGCTGGGCCTCAGTCCCGGCCGCTGAGACCGCAGCCCCCTCAGGAGTGCGAGGCTTCGCGGCGGAGCCCCGCTGAG

GACGAGGCTCTCGGCTGAGTGACGACCCCCGGGCCATGGAGAGGCG - UNI34449 - - UNI36262 - GATCAAAGAAGACATTCTGGGTCAACA

GTCCTGGCCAGCGGCACAGCAGGCATCATGAGCAAGCACAGAGAAGACTGCTTAAGGGGACAG - UNI34449 - - UNI36262 - GACTAGCTAA

GTCTCTTCAGCAGTGTTCCCTCACTGATGGAGAATTACTTCCAAGCAGAGGCTTACAACCTGGACAAGGTATTAGATGAATTTGAACAAAATGAAG - U

NI35120 - - UNI36262 - ATGAAACAGTTTCTCCTACTTTATTGGATACAAAGTGGAATAAGATTTTAGATCCCTCTTCTCACCCATTGTCTTTT

AACCCTGCATTAGCCAGTGTGAATGAACCTACAGTTTCTGAGACAGGACCACAGCTGAAAGTCTTCTCTCTGGCTGGCTCAGCTCCCCTTACAAAGGAGG

ACAAAGATCCCTGTGCTAACGGACAGGACTGTAGTCTAAATCCAGAGACTGACACCATGTGGATTGATGAAAATGCTGTGACAGAAGACCAACTAATTAA

GAGAAACTATAATCAGGATGATCAATTTAGTGCCGTTGAAGTGGGAGAGGAGAAATGTGGAAGCCTCACTTGTCTGCCAGACGAGAAGAATGTTCTGGTT

GTAGCTGTCATGCATAACTGCGATAAAAGGACATTGCAAAGCGATTTGCAGGATTGTAATAATTACAATAGTCAATCCCTCATGAATTCTTTTAGTTGTT

CACTGGATAATGAGACTAGACAAACTGATCAATTTAGTTTTAGTATGAATGGGTCCACGGAAAAAGGTATAAACTCGGAGAAACAAATGGATGCTTTGAA

TAAACCAAAACCAGAGAGGGATTCTGTGAATCATCTCTGTGCGGCTTCATCTAACAGTGCAACCAGTATCTCTTCCCCTTCACAATTGAAGGACGGTGAG

AATGTGGGTAGAGACCCATCTACATCTACAGTTACAAGCTTAGCAGTTAATTCATCCCAGGGAATGGATGGAGGGCCTGCCATTAAACAGCAAGGAAATT

ATATGCCAGATGAGGATCTTTCTGGCATGAACAGCTCTTCCAGGACAGACCTAGGGATCTCCAACTCCTTTTCCCACTCAAGTGGAGAGCTCTTAATAAA

AACAGAGCCAGCTGAGGAGAGGACAGCTGAAGACTCCCTCCCATCTGATTTATCTTTGAATCTCAAGCCGGATACTCCTGCTTTATCTGGAAGGGACAAT

TGCGAACAGTCTTCAGACTGCCTTGGGTCTAGTGAAACTAGAGCTGATGAAGATGAAGGTAATGACTCTCAGATGACTAATTGGAAATTAACGAAGCTAA

ATGAGATGAGTGATAGCCAAGTGAATGAAGAAAATCAAATGGCTTTACAGAGTAATCAACCTGAGGACACTAATAGTGGAGGCGAGTGTGTTGGAATGGC

AGATTCTGATCTAGATTTCAAAGGAACTTGCATGAATGAGAGTGAAGGATATGATTTCTCCACTGTTAATGATGCACCAGCAGCAAATTCTCTATCTAAT

AGTTGTGATTCCTATGGAATGCAGAGCCCAATTGTATCTTTTGTTCCAAAGACATTACCCTCCAAAGAAGATTCAGTAACAGAAGAAAAAGAAATAGAAG

AGAGCAAGTCAGAATGCTATTCAAATATTTATGAACAGAGAGGAAACGAGAATGCAGAAGGGAGTGGACTGCTTTTAAACAGCACTGGGAATGTAATGAA

GAAAAATTATTTACATAATTTCTGTAGTCAAATCCCATCAGTACTTGGGCAATCTTCCCCCAAGATAGCAAACCTGCAATCTATTAGTGTTCCTTTTGGT

GGTGCAAGACCCAAGCAACCTTCTAATCTTAAACTTCAGATTCCAAAGCCATTATCAGACCATTTACAAAATGACCTTCCTGCAAACAATGGAAATAATA

GTAAAAACAAAAATGATGTTCTTGGGAAAGCAAAGCTAGGGGAGAACTCAGCAGTCAACGCATGCAGTGCGACTCTGGGAAACATCTCTGTAACTGATAC

AAATGGGGAACATTTAGAAACTTATGAGGCTGAGATCTCCAGTAGACCATGCCTTGCACTAGCTCCAGATAGTCCAGATAATGATCTCCGAGCTAGTCAG

TTTGGAATTTCTGCAAGAAAGCCATTTACCACCCTAGGTGAGGTGGCACCAGTATGGGTACCAGATTCCCAGGCTCCAAACTGCATGAAGTGTGAAGCTC

GGTTTACATTCACCAAAAGGAGGCATCACTGCAGAGCGTGTGGGAAG - UNI35120 - GTTTTCTGTGCTTCCTGCTGCAGCCTAAAATGCAAACTG

CTGTACATGGACAGAAAGGAAGCCAGAGTGTGTGTAATCTGTCACTCAGTGCTGATGAATG - UNI35120 - CTCAAGCCTGGGAGAACATGATGAG

TGCCTCAAGCCAGAGCCCTAACCCTAACAATCCTGCTGAATACTGTTCTACTATCCCTCCCTTGCAGCAAGCTCAGGCCTCAGGAGCCCTGAGCTCTCCA

CCTCCCACTGTGATGGTACCTGTGGGAGTTTTAAAGCACCCTGGAACAGAAG TGCCTCAGCCCAGAGAGCAGAGGAGAGTTTGGTTTGCTGATGGGATC

TTACCTAATGGAGAAGTTGCTGATGCAGCCAAATTAACAATGAATGGAACTTCCTCTGCAGGAACTCTGGCTGTGTCACATGACCCAGTCAAGCCTGTAG

CCACCAGTCCTCTTCCAACAGAG GCTGATACTTCTCTGTTCTCTGGGAGCATTACTCAGGTTGGAAGTCCTGTTGGAAGTGCAATGAACCTTATTCCTG

AAGATGGCCTTCCTCCCATCCTCATCTCCACTGGTGTGAAAGGAG - UNI20101 - ATTATGCTGTGGAAGAGAAACCATCACAGATTTCAGTCATG

CAGCAACTGGAGGATGGTGGCCCTGACCCACTTGTCTTTGTTTTAAATGCAAATTTATTGTCAATGGTTAAAATTGTAAATT ATGTGAACAGGAAGTGC

TGGTGTTTTACAACCAAAGGGATGCATGCCGTGGGTCAATCTGAGATAGTTATTCTTCTGCAGTGTCTGCCAGATGAGAAATGTTTGCCTAAGGACATCT

TTAATCACTTTGTACAGCTTTACCGGGACGCCCTGGCAG GGAATGTTGTGGGCAGCCTGGGACATTCTTTCTTCAGTCAAAGTTTCCTGGGCAGTAAAG

AACATGGTGGGTTCTTGTATGTGACATCTACCTACCAGTCACTGCAAGACCTGGTGCTTCCAACCCCTCCTTACCTGTTTGGGATTCTCATCCAGAAATG

GGAAACTCCTTGGGCCAAAGTGTTTCCCATACGACTCTTGTTAAGACTTGGAGCTGAATATCGAC TTTACCCCTGTCCACTGTTCAGTGTCAGATTTCG

GAAGCCATTATTTGGAGAGACTGGCCATACCATCATGAATCTTCTAGCA GACTTCCGAAATTACCAGTATACTCTGCCAGTTGTCCAAGGTTTAGTGGT

TGATATGGAAGTTCGAAAAACAAGCATCAAAATTCCCAGCAACAGATATAATGAG - UNI28024 - ATGATGAAAGCCATGAACAAATCCAATGAAC

ATGTACTGGCAGGAGGTGCCTGCTTCAATGAAAAGGCAGATTCTCATCTTGTGTGTGTACAGAACGATGATGGAAACTATCAAACCCAGGCCATCAGTAT

TCACAATCAGCCCAGGAAAG TGACTGGCGCCAGTTTCTTTGTGTTCAGTGGCGCACTGAAATCCTCTTCAGGATACCTTGCCAAGTCCAGTATTGTAGA

AG ATGGAGTCATGGTCCAGATCACTGCGGAGAACATGGACTCCTTGAGGCAGGCACTGCGGGAGATGAAGGACTTTACCATCACTTGTGGGAAGGCGGA

TGCAGAGGACCCCCAGGAACAGATCCACATCCAGTGGGTGGACGATGACAAGACAGTTAACAAAGG TGTGGTGAGTCCTATAGATGGGAAGTCTATGGA

ATCTATAACAAACGTGAAAATATTCCATGGGTCAGAGTATAAAGCAAACGGAAAAGTCATCAGATGGACAGAG GTGTTTTTCCTGGAAAACGATGACCA

CCATAACTGCCTGAGTGACCCTGCAGATCACAGCAGACTGACTGAGCATGTCGCCAAGGCATTCTGCCTCGCCCTCTGCCCCCACCTGAAGCTTTTAAAA

GAAGATGGAATGACAAAACTGGGACTCCGTGTGACGCTTGACTCAGATCAG GTTGGCTATCAAGCAGGGAGCAATGGCCAGCCCCTTCCCTCGCAGTAC

ATGAACGATCTGGACAGTGCCTTGGTGCCTGTCATTCATGGAGGAGCCTGCCAGCTCAGTGAAGGCCCTGTCGTCATGGAACTCATCTTTTATATTCTGG

AAAACATCGCATAGATGAGGACTCCATTGTTTCTGTTCAGACCTGTTGCAGCAGCAGTCATATCCAAATCATTTGCACTTTAAAACTGGAAGATTAAGCT

TTTTGTTAACACTGTCAGTAGGGAGGGTTTGGGGTGGGAATAGGACTTAGGGGAGATGGGGTGGGGAGGGTGGTAGGGGACAGATGTTCCATGATTCTAA

GTCTTCTATGCATTCTCCAAGAAGACCCGGGCAGCTTCTTACTGCACAACAGATATGCTATCTTTGCAGCTAACTCCCTTCTGTTACTGTCTAGACAAGA

CTTCTGCTCCTCTCTTATGATTACTTCCGGTCATGTGCTCAGATGAATGCTCATATGGGCACAACCATCACCAAGGTCACAATGGGGGGCAGAAAGGAAA

TAAACAATGAATCGTCACTTTTGTACTTCCTGTACAGAACTGGCATAAAAAGACCGCTATGCTGATCATCCTGGTTGCACCCCCAGCTGTTTGTCATGTT

TAGATTCGTGTTTATTTGTTCAGATTACTAACTGAATCAAACCAAAGGGGTTTCTGGTCTGTTAGCCAGGGAAGGTAACTCAGTATAAACCAGGGCATTT

GGATAGAGAAGCTGAGTGACAGCTGGCAATGGGCACCCAGGGCATTGTTATTTACTACACACTAGAAGTATTTTTAAAGAACATTTTACTAAGAAATCTC

TTAAACTCCAGGAAAGTTGTACATGAAAAAAAAAAACAAGGCGTCTTTTCTACAGCCCCACGGACACACGCTCACAGGGACGCATACACACACACACACG

GACGCACACGCTCACACACTAGCACTTTGCCCCTTTGGTTCGTCAGTGCTTGTCTTCCCCTCCTCTATTAAACTGAGGTATTTCAGATTAAGGTGCATAC

AGTACAGCCCCTCATCCTTAAGTCAAGTCACAGTGTCTGGAGGCTCTAACCTCATACCTGCCCAGAACCTTTGGGAACCTTTCTTCAACAGAGAACTTTC

CAGTTTAGTATCAGACGCTGCACATAGCTTTAAGCTTGTCTTTATCTCTTTGTGGCATGGAATTTTTTTTTTTTTTTTTGGGCCCTCACATCCTGGATTT

TTGTTTGGTTTTAGTAGAAAATACCTCATTTGAGTTTGGATTATTGGCCAGAAACACTTGATATCCATCTGCCTTTCAGAGACAGTGGCAAAGCTCATTA

TCACCAGTACACCATGTCCAGTTTCCCAACTATGTATTTACCCTTTTAGTAATAACTAATATATGCAGAACTTTTCAATCTATGCAAAGATCTTGCTCCT

CAAAATTCCCCTTCGGTTTAGCACCACTGATGTTTTCTTGCCTGCACTGCTCTTTCACTATGACAGCTGTAAAATGACTTTCTAGTTTCAGCATGGCCCT

TTCTTTATGAGCTGGATTTAATAGACTCAAAACAAATAAGCCCCTCCTTCCTTTGTCCTTTATTCATGGAGTTTTCTTGTTGGTCCTGTGGACTTCTACG

GTCTTAGTCTTGTACTCGGGTGATGTCTTCTTTGGTTAATTTGAACACCTTCAAGCTGGCTCCTGCATCCTTTTCAAGGTATACTTAGGTTTAATCCTTC

CTGTGTCGCCTAACAAGAAGCCCCAGGCTAATCTTGCACTTACCCTGCTCACTTTATCTCCAGGCAGCCCTTTAACTGGAGTACAGGAAACAAAGATCTG

GTTCACCGAAGATATATGTGATACTGACTGGCTGGCCTGGAGCTCAGAGATCTGCCTGCCTCTGCCTCCCAAGCGCTGGGATTAAAGTTGTGTGCCATTA

CACTCAA
Translation
 - UNI34449 - - UNI36262 -  - UNI34449 - - UNI36262 - MENYFQAEAYNLDKVLDEFEQNED - UNI35120 - - UNI362

62 - DETVSPTLLDTKWNKILDPSSHPLSFNPALASVNEPTVSETGPQLKVFSLAGSAPLTKEDKDPCANGQDCSLNPETDTMWIDENAVTEDQLIKRN

YNQDDQFSAVEVGEEKCGSLTCLPDEKNVLVVAVMHNCDKRTLQSDLQDCNNYNSQSLMNSFSCSLDNETRQTDQFSFSMNGSTEKGINSEKQMDALNKP

KPERDSVNHLCAASSNSATSISSPSQLKDGENVGRDPSTSTVTSLAVNSSQGMDGGPAIKQQGNYMPDEDLSGMNSSSRTDLGISNSFSHSSGELLIKTE

PAEERTAEDSLPSDLSLNLKPDTPALSGRDNCEQSSDCLGSSETRADEDEGNDSQMTNWKLTKLNEMSDSQVNEENQMALQSNQPEDTNSGGECVGMADS

DLDFKGTCMNESEGYDFSTVNDAPAANSLSNSCDSYGMQSPIVSFVPKTLPSKEDSVTEEKEIEESKSECYSNIYEQRGNENAEGSGLLLNSTGNVMKKN

YLHNFCSQIPSVLGQSSPKIANLQSISVPFGGARPKQPSNLKLQIPKPLSDHLQNDLPANNGNNSKNKNDVLGKAKLGENSAVNACSATLGNISVTDTNG

EHLETYEAEISSRPCLALAPDSPDNDLRASQFGISARKPFTTLGEVAPVWVPDSQAPNCMKCEARFTFTKRRHHCRACGK - UNI35120 - VFCASC

CSLKCKLLYMDRKEARVCVICHSVLMNA - UNI35120 - AQAWENMMSASSQSPNPNNPAEYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGT

EV VPQPREQRRVWFADGILPNGEVADAAKLTMNGTSSAGTLAVSHDPVKPVATSPLPTE ADTSLFSGSITQVGSPVGSAMNLIPEDGLPPILISTGVK

GD - UNI20101 - DYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVKIVNY YVNRKCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFN

HFVQLYRDALAG GNVVGSLGHSFFSQSFLGSKEHGGFLYVTSTYQSLQDLVLPTPPYLFGILIQKWETPWAKVFPIRLLLRLGAEYRL LYPCPLFSVR

FRKPLFGETGHTIMNLLA DFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNE - UNI28024 - MMKAMNKSNEHVLAGGACFNEKADSHLVCVQN

DDGNYQTQAISIHNQPRKV VTGASFFVFSGALKSSSGYLAKSSIVED DGVMVQITAENMDSLRQALREMKDFTITCGKADAEDPQEQIHIQWVDDDKT

VNKG GVVSPIDGKSMESITNVKIFHGSEYKANGKVIRWTE VFFLENDDHHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSD

Q VGYQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIA
Transcript ENSMUST00000106660
Sequence
ATGGAGAATTACTTCCAAGCAGAGGCTTACAACCTGGACAAGGTATTAGATGAATTTGAACAAAATGAAG - UNI35120 - - UNI36262 - ATG

AAACAGTTTCTCCTACTTTATTGGATACAAAGTGGAATAAGATTTTAGATCCCTCTTCTCACCCATTGTCTTTTAACCCTGCATTAGCCAGTGTGAATGA

ACCTACAGTTTCTGAGACAGGACCACAGCTGAAAGTCTTCTCTCTGGCTGGCTCAGCTCCCCTTACAAAGGAGGACAAAGATCCCTGTGCTAACGGACAG

GACTGTAGTCTAAATCCAGAGACTGACACCATGTGGATTGATGAAAATGCTGTGACAGAAGACCAACTAATTAAGAGAAACTATAATCAGGATGATCAAT

TTAGTGCCGTTGAAGTGGGAGAGGAGAAATGTGGAAGCCTCACTTGTCTGCCAGACGAGAAGAATGTTCTGGTTGTAGCTGTCATGCATAACTGCGATAA

AAGGACATTGCAAAGCGATTTGCAGGATTGTAATAATTACAATAGTCAATCCCTCATGAATTCTTTTAGTTGTTCACTGGATAATGAGACTAGACAAACT

GATCAATTTAGTTTTAGTATGAATGGGTCCACGGAAAAAGGTATAAACTCGGAGAAACAAATGGATGCTTTGAATAAACCAAAACCAGAGAGGGATTCTG

TGAATCATCTCTGTGCGGCTTCATCTAACAGTGCAACCAGTATCTCTTCCCCTTCACAATTGAAGGACGGTGAGAATGTGGGTAGAGACCCATCTACATC

TACAGTTACAAGCTTAGCAGTTAATTCATCCCAGGGAATGGATGGAGGGCCTGCCATTAAACAGCAAGGAAATTATATGCCAGATGAGGATCTTTCTGGC

ATGAACAGCTCTTCCAGGACAGACCTAGGGATCTCCAACTCCTTTTCCCACTCAAGTGGAGAGCTCTTAATAAAAACAGAGCCAGCTGAGGAGAGGACAG

CTGAAGACTCCCTCCCATCTGATTTATCTTTGAATCTCAAGCCGGATACTCCTGCTTTATCTGGAAGGGACAATTGCGAACAGTCTTCAGACTGCCTTGG

GTCTAGTGAAACTAGAGCTGATGAAGATGAAGGTAATGACTCTCAGATGACTAATTGGAAATTAACGAAGCTAAATGAGATGAGTGATAGCCAAGTGAAT

GAAGAAAATCAAATGGCTTTACAGAGTAATCAACCTGAGGACACTAATAGTGGAGGCGAGTGTGTTGGAATGGCAGATTCTGATCTAGATTTCAAAGGAA

CTTGCATGAATGAGAGTGAAGGATATGATTTCTCCACTGTTAATGATGCACCAGCAGCAAATTCTCTATCTAATAGTTGTGATTCCTATGGAATGCAGAG

CCCAATTGTATCTTTTGTTCCAAAGACATTACCCTCCAAAGAAGATTCAGTAACAGAAGAAAAAGAAATAGAAGAGAGCAAGTCAGAATGCTATTCAAAT

ATTTATGAACAGAGAGGAAACGAGAATGCAGAAGGGAGTGGACTGCTTTTAAACAGCACTGGGAATGTAATGAAGAAAAATTATTTACATAATTTCTGTA

GTCAAATCCCATCAGTACTTGGGCAATCTTCCCCCAAGATAGCAAACCTGCAATCTATTAGTGTTCCTTTTGGTGGTGCAAGACCCAAGCAACCTTCTAA

TCTTAAACTTCAGATTCCAAAGCCATTATCAGACCATTTACAAAATGACCTTCCTGCAAACAATGGAAATAATAGTAAAAACAAAAATGATGTTCTTGGG

AAAGCAAAGCTAGGGGAGAACTCAGCAGTCAACGCATGCAGTGCGACTCTGGGAAACATCTCTGTAACTGATACAAATGGGGAACATTTAGAAACTTATG

AGGCTGAGATCTCCAGTAGACCATGCCTTGCACTAGCTCCAGATAGTCCAGATAATGATCTCCGAGCTAGTCAGTTTGGAATTTCTGCAAGAAAGCCATT

TACCACCCTAGGTGAGGTGGCACCAGTATGGGTACCAGATTCCCAGGCTCCAAACTGCATGAAGTGTGAAGCTCGGTTTACATTCACCAAAAGGAGGCAT

CACTGCAGAGCGTGTGGGAAG - UNI35120 - GTTTTCTGTGCTTCCTGCTGCAGCCTAAAATGCAAACTGCTGTACATGGACAGAAAGGAAGCCAG

AGTGTGTGTAATCTGTCACTCAGTGCTGATGAATG - UNI35120 - CTCAAGCCTGGGAGAACATGATGAGTGCCTCAAGCCAGAGCCCTAACCCTA

ACAATCCTGCTGAATACTGTTCTACTATCCCTCCCTTGCAGCAAGCTCAGGCCTCAGGAGCCCTGAGCTCTCCACCTCCCACTGTGATGGTACCTGTGGG

AGTTTTAAAGCACCCTGGAACAGAAG TGCCTCAGCCCAGAGAGCAGAGGAGAGTTTGGTTTGCTGATGGGATCTTACCTAATGGAGAAGTTGCTGATGC

AGCCAAATTAACAATGAATGGAACTTCCTCTGCAGGAACTCTGGCTGTGTCACATGACCCAGTCAAGCCTGTAGCCACCAGTCCTCTTCCAACAGAG GC

TGATACTTCTCTGTTCTCTGGGAGCATTACTCAGGTTGGAAGTCCTGTTGGAAGTGCAATGAACCTTATTCCTGAAGATGGCCTTCCTCCCATCCTCATC

TCCACTGGTGTGAAAGGAG - UNI20101 - ATTATGCTGTGGAAGAGAAACCATCACAGATTTCAGTCATGCAGCAACTGGAGGATGGTGGCCCTGA

CCCACTTGTCTTTGTTTTAAATGCAAATTTATTGTCAATGGTTAAAATTGTAAATT ATGTGAACAGGAAGTGCTGGTGTTTTACAACCAAAGGGATGCA

TGCCGTGGGTCAATCTGAGATAGTTATTCTTCTGCAGTGTCTGCCAGATGAGAAATGTTTGCCTAAGGACATCTTTAATCACTTTGTACAGCTTTACCGG

GACGCCCTGGCAG GGAATGTTGTGGGCAGCCTGGGACATTCTTTCTTCAGTCAAAGTTTCCTGGGCAGTAAAGAACATGGTGGGTTCTTGTATGTGACA

TCTACCTACCAGTCACTGCAAGACCTGGTGCTTCCAACCCCTCCTTACCTGTTTGGGATTCTCATCCAGAAATGGGAAACTCCTTGGGCCAAAGTGTTTC

CCATACGACTCTTGTTAAGACTTGGAGCTGAATATCGAC TTTACCCCTGTCCACTGTTCAGTGTCAGATTTCGGAAGCCATTATTTGGAGAGACTGGCC

ATACCATCATGAATCTTCTAGCA GACTTCCGAAATTACCAGTATACTCTGCCAGTTGTCCAAGGTTTAGTGGTTGATATGGAAGTTCGAAAAACAAGCA

TCAAAATTCCCAGCAACAGATATAATGAG - UNI28024 - ATGATGAAAGCCATGAACAAATCCAATGAACATGTACTGGCAGGAGGTGCCTGCTTC

AATGAAAAGGCAGATTCTCATCTTGTGTGTGTACAGAACGATGATGGAAACTATCAAACCCAGGCCATCAGTATTCACAATCAGCCCAGGAAAG TGACT

GGCGCCAGTTTCTTTGTGTTCAGTGGCGCACTGAAATCCTCTTCAGGATACCTTGCCAAGTCCAGTATTGTAGAAG ATGGAGTCATGGTCCAGATCACT

GCGGAGAACATGGACTCCTTGAGGCAGGCACTGCGGGAGATGAAGGACTTTACCATCACTTGTGGGAAGGCGGATGCAGAGGACCCCCAGGAACAGATCC

ACATCCAGTGGGTGGACGATGACAAGACAGTTAACAAAGG TGTGGTGAGTCCTATAGATGGGAAGTCTATGGAATCTATAACAAACGTGAAAATATTCC

ATGGGTCAGAGTATAAAGCAAACGGAAAAGTCATCAGATGGACAGAG GTGTTTTTCCTGGAAAACGATGACCACCATAACTGCCTGAGTGACCCTGCAG

ATCACAGCAGACTGACTGAGCATGTCGCCAAGGCATTCTGCCTCGCCCTCTGCCCCCACCTGAAGCTTTTAAAAGAAGATGGAATGACAAAACTGGGACT

CCGTGTGACGCTTGACTCAGATCAG GTTGGCTATCAAGCAGGGAGCAATGGCCAGCCCCTTCCCTCGCAGTACATGAACGATCTGGACAGTGCCTTGGT

GCCTGTCATTCATGGAGGAGCCTGCCAGCTCAGTGAAGGCCCTGTCGTCATGGAACTCATCTTTTATATTCTGGAAAACATCGCATAG
Translation
MENYFQAEAYNLDKVLDEFEQNED - UNI35120 - - UNI36262 - DETVSPTLLDTKWNKILDPSSHPLSFNPALASVNEPTVSETGPQLKVFS

LAGSAPLTKEDKDPCANGQDCSLNPETDTMWIDENAVTEDQLIKRNYNQDDQFSAVEVGEEKCGSLTCLPDEKNVLVVAVMHNCDKRTLQSDLQDCNNYN

SQSLMNSFSCSLDNETRQTDQFSFSMNGSTEKGINSEKQMDALNKPKPERDSVNHLCAASSNSATSISSPSQLKDGENVGRDPSTSTVTSLAVNSSQGMD

GGPAIKQQGNYMPDEDLSGMNSSSRTDLGISNSFSHSSGELLIKTEPAEERTAEDSLPSDLSLNLKPDTPALSGRDNCEQSSDCLGSSETRADEDEGNDS

QMTNWKLTKLNEMSDSQVNEENQMALQSNQPEDTNSGGECVGMADSDLDFKGTCMNESEGYDFSTVNDAPAANSLSNSCDSYGMQSPIVSFVPKTLPSKE

DSVTEEKEIEESKSECYSNIYEQRGNENAEGSGLLLNSTGNVMKKNYLHNFCSQIPSVLGQSSPKIANLQSISVPFGGARPKQPSNLKLQIPKPLSDHLQ

NDLPANNGNNSKNKNDVLGKAKLGENSAVNACSATLGNISVTDTNGEHLETYEAEISSRPCLALAPDSPDNDLRASQFGISARKPFTTLGEVAPVWVPDS

QAPNCMKCEARFTFTKRRHHCRACGK - UNI35120 - VFCASCCSLKCKLLYMDRKEARVCVICHSVLMNA - UNI35120 - AQAWENMMSASS

QSPNPNNPAEYCSTIPPLQQAQASGALSSPPPTVMVPVGVLKHPGTEV VPQPREQRRVWFADGILPNGEVADAAKLTMNGTSSAGTLAVSHDPVKPVAT

SPLPTE ADTSLFSGSITQVGSPVGSAMNLIPEDGLPPILISTGVKGD - UNI20101 - DYAVEEKPSQISVMQQLEDGGPDPLVFVLNANLLSMVK

IVNY YVNRKCWCFTTKGMHAVGQSEIVILLQCLPDEKCLPKDIFNHFVQLYRDALAG GNVVGSLGHSFFSQSFLGSKEHGGFLYVTSTYQSLQDLVLP

TPPYLFGILIQKWETPWAKVFPIRLLLRLGAEYRL LYPCPLFSVRFRKPLFGETGHTIMNLLA DFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNE

 - UNI28024 - MMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKV VTGASFFVFSGALKSSSGYLAKSSIVED DGVMV

QITAENMDSLRQALREMKDFTITCGKADAEDPQEQIHIQWVDDDKTVNKG GVVSPIDGKSMESITNVKIFHGSEYKANGKVIRWTE VFFLENDDHHNC

LSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQ VGYQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENI

A

For any suggestions or comments, please send an email to unitrap@crg.es