Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034563 (Ccpg1)
Chromosomal location
Chr 9: 72833385 - 72863798 (+)
Description
cell cycle progression 1 Gene [Source:MGI Symbol;Acc:MGI:1196419]
RefSeq_dna
NM_028181 
RefSeq_peptide
NP_082457.3 NP_001107800.1 
UniGene
Mm.268475 
MGI
MGI:1196419 
Uniprot/SWISSPROT
Q640L3 
Human Ortholog
ENSG00000214882 (CCPG1)
Omim not available
UniTrap UNI17235
Vector Insertion
Chr 9: 72833481 - 72845208
Public Clones (sanger) D137A03 (ggtc) IST14510A8 (tigm) IST14508D7 (tigm) IST13571C3 (tigm)
IST12794A1 (tigm) IST14287B1 (tigm) IST15068A6 (tigm) IST14539C6 (tigm)
IST14175E3 (tigm) IST14313H10 (tigm) IST10602H2 (tigm) IST14191H11 (tigm)
IST10890G11 (tigm) IST10548C4 (tigm) IST11097H6 (tigm) IST15068A7 (tigm)
Private Clones OST447105 (lexicon) OST415504 (lexicon) OST328419 (lexicon) OST319709 (lexicon)
OST280687 (lexicon) OST272796 (lexicon) OST252394 (lexicon) OST207439 (lexicon)
OST184491 (lexicon) OST168520 (lexicon) OST150478 (lexicon) OST138616 (lexicon)
OST101493 (lexicon) OST77416 (lexicon) OST41302 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21882
Vector Insertion
Chr 9: 72845278 - 72846830
Public Clones not available
Private Clones OST314859 (lexicon) OST313179 (lexicon) OST289773 (lexicon) OST279648 (lexicon)
OST249279 (lexicon) OST116815 (lexicon) OST113894 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23303
Vector Insertion
Chr 9: 72846952 - 72847269
Public Clones not available
Private Clones OST266275 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21523
Vector Insertion
Chr 9: 72847347 - 72849483
Public Clones not available
Private Clones OST327230 (lexicon) OST306574 (lexicon) OST301794 (lexicon) OST245965 (lexicon)
OST234033 (lexicon) OST222541 (lexicon) OST210379 (lexicon) OST208058 (lexicon)
OST179062 (lexicon) OST170451 (lexicon) OST132825 (lexicon) OST115997 (lexicon)
OST114926 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000037977
Sequence
AGGTTGTTGTTTTTATGAGGCGTCACTGGCGTCTGGAGCGCGGACGCCGCCACGGTGACAGCTGGCGCGGTCGGGCGGAAGAGGCGCTGTCTTCGG - U

NI17235 - ACCTGAAAAATGTCTGAAAGTTCCAGCGACAGCGACTCATCTTGTGGCTGGACTGTCATCAATCATGAG - UNI21882 - GGTTCTG

ATATAGAGATCGTGAATTCTGCCACAGCCAGTGACAACTGTGGACTGACTCTAGAATGTTCCTTAGTAGAACAAGAGGAGCTGCCCGTTCTTTATGTAGG

GCATGGAGGTGAAG - UNI23303 - AAAGCAGCGCAAACAACACATCGTCAGTGGGAGAAACCATGTTGTCATCAATGAGAGAAACCAAGTCAGCAG

CTGAG - UNI21523 - GTGGAGGAAGCACCTTCCCCTGAAGACAATGTCTATTTCGGAACTACTAGTGACGATTCGGATATTGTTACACTTGAACCA

CCTAAGCTGGAAGAAATGGGGAACCAGGAAGTTACAATTCAAGAAGCGCCCAGCTCAGATGACCTTAACATGGGCTCTTCCTCCAGCAGCCAGTACGCCT

TCTGCCAGCCAGAACCCG TCTTTTCATCTCAGCCTAGTGATGAGGAATCCAGTAGCGATGACACCAGCCACGAGCCCAGCCCTGCTCCTAGACGGCGCC

GCAACAGGAAGAAGACCGTTTCTATCTCAGAGTCTGAGGAGCCTCCACTCGCTGAGCCGGAAGATGAGCCCTCCAAGGAGCCAAGTAAACGCCACTTTAG

TCGTGGTCTCAACAAGTGTGTTATCCTGGCCTTGGTGATTGCTGTCAGCATGGGATTTGGACATTTCTATG GCACAATCCAGATTCAGAAGCAGTTAGT

CAGAAAGACCCACGAAGATGAGCTGGATGGTGTGAAGGGTTATCTCTCACAGCGCAAGCAGGAACAAGAGTCTTTTCTAGATTTCAAG TCGCTGAAAGA

AAACCTTGAGAGGTGTTGGACCGTTACTGAATCAGAGAAGATTACCTTTGAAACTCAGAAGAAGAACCTTGCTGCAGAAAACCAGTATTTACGAATATCT

CTGGAGAAGGAAGAACAAGCCCTGTCTTCATTACAGGAAGAGCTACGGCAACTAAGGGAGCAGATTAGATTGTTGGAGGATAAAGGCACAAGCACGCAGT

TAGTTAGGGAGAACCAGGTCCTTAAGCAGTACTTAGAAGTGGAAAAGCAGAAAACAGATAGCTTCCTTAGGGAAAGGGAGATGCTCTTGGAGGAGGCAAG

GATGCTGAAAAGGGACCTGGAGAGGGAACAGCTCACAGCCATGGCTCTGCGGGCAGAACTTGAGCAGTTCATCCCTGGCCAGGCACAGAGCCGTGCGGAG

TCTCCTAGTGTGCAGACTGAAGAGAAGGAAGTGGGGCTGTTACAGCAGAGGCTGGCTGAGCTGGAGCAGAAGCTCATCTTTGAGCAGCAGCGCTCGGATT

TGTGGGAGAGACTGTACGTTGAGGCAAAGGATCAACATGGAAAGCAGGAGACAGACGGGAGGAAGAGAGGAAGCAGAGGAAGCCACAGGGCGAAGAGCAA

GTCGAAGGAGACATTTCTGGGGACAGTTAAGGAAACATTTGATGCTATGAAGAATTCTACCAAGGAGTTTGTGAGACATCATAAAGAAAAAATCAAGCAG

GCGAAAGAAGCTGTGAAGGAGAATCTGAAAAAATTCTCAGATTCAGTCAAATCCACTTTTCGCCATTTCAAAGATACTACCAAGAATATCTTTGATGAAA

AGGGCAGCAAGAGATTCAGGGCTCCAAAAGAAGCGGCAACTGAAAAGACAAGAACAGCTTATAGTTATTCCTCATACTCACAGCAGGAGGCACCAAACCA

AAACCAGAATTGCAGGCGCCCTTCTGCACAGAGGGATGGAGGGAGAGAAAAGCCCAGTCACTCTGAAGAAATTAGAAAGAATGCAAATTCATATACATAC

AAGGCCAAGTCTGACTGCAGAGGCACCCATTCCACCAGAAGGGTTTGTTCAG TCGACCTGATAAAAAGCAACGTATGGTAACTATTGAAAACGCCAGGC

ACCGAAAACAAGAGCAGAAGCACCTTCATCCACAGCCTTATGAAAGGGAAGGTAAATGGCAAAAATACGGTCGCGCTAACGGAAGACACACGGCAAATCT

TGAGCTAGAACTGGGGCAGTTACCTTTCGATCCTAAGTACTGATTTGTGATTAAGTTAGGAAGTTAAGAGCTGTGGATGCTATCTACTTGGTTTGATGTT

GAGATGAACTCCCCATGACTGTCTTTATATTATGCAAAAGCAAAGCTTACTAACTTGCATTTTCCTGTAGCTTAGGTTTGTTAAAAACAAAAACTTTTTT

TCCTGCTGGGGGGGGGTGGGGGAAATGGTAGTTTTATTAAGGAAGCCAGGCATGAAATAGTCTGTGCATGAAACAGGGCTTGGTTTGAGGAGCTGAGCTC

AGCTCACACAGGCATTTCGTGCCGTGTGGAGGTGTGCAGCAGGGCCTGAGGACTGTGCTGAGGCGGGACTCCGCGCTAACATCTCTACTCTCACGCTTTT

GTCTCTCTGTGGGTTCAAGAGCCCGTTGGTTTGTGAAGAGCTGGCTGGCTTGTCTTGTGAACTCTCTTGCACACCTGAATGCTATGGAAGAAACAATAAA

CTGCACCGTGAGG
Translation
 - UNI17235 - MSESSSDSDSSCGWTVINHE - UNI21882 - GSDIEIVNSATASDNCGLTLECSLVEQEELPVLYVGHGGEE - UNI23303

 - ESSANNTSSVGETMLSSMRETKSAAE - UNI21523 - VEEAPSPEDNVYFGTTSDDSDIVTLEPPKLEEMGNQEVTIQEAPSSDDLNMGSSSSS

QYAFCQPEPV VFSSQPSDEESSSDDTSHEPSPAPRRRRNRKKTVSISESEEPPLAEPEDEPSKEPSKRHFSRGLNKCVILALVIAVSMGFGHFYG GTI

QIQKQLVRKTHEDELDGVKGYLSQRKQEQESFLDFK SLKENLERCWTVTESEKITFETQKKNLAAENQYLRISLEKEEQALSSLQEELRQLREQIRLLE

DKGTSTQLVRENQVLKQYLEVEKQKTDSFLREREMLLEEARMLKRDLEREQLTAMALRAELEQFIPGQAQSRAESPSVQTEEKEVGLLQQRLAELEQKLI

FEQQRSDLWERLYVEAKDQHGKQETDGRKRGSRGSHRAKSKSKETFLGTVKETFDAMKNSTKEFVRHHKEKIKQAKEAVKENLKKFSDSVKSTFRHFKDT

TKNIFDEKGSKRFRAPKEAATEKTRTAYSYSSYSQQEAPNQNQNCRRPSAQRDGGREKPSHSEEIRKNANSYTYKAKSDCRGTHSTRRVCSV VDLIKSN

VW
Transcript ENSMUST00000085350
Sequence
AGGTTGTTGTTTTTATGAGGCGTCACTGGCGTCTGGAGCGCGGACGCCGCCACGGTGACAGCTGGCGCGGTCGGGCGGAAGAGGCGCTGTCTTCGG - U

NI17235 - ACCTGAAAAATGTCTGAAAGTTCCAGCGACAGCGACTCATCTTGTGGCTGGACTGTCATCAATCATGAG - UNI21882 - GGTTCTG

ATATAGAGATCGTGAATTCTGCCACAGCCAGTGACAACTGTGGACTGACTCTAGAATGTTCCTTAGTAGAACAAGAGGAGCTGCCCGTTCTTTATGTAGG

GCATGGAGGTGAAG - UNI23303 - AAAGCAGCGCAAACAACACATCGTCAGTGGGAGAAACCATGTTGTCATCAATGAGAGAAACCAAGTCAGCAG

CTGAG - UNI21523 - GTGGAGGAAGCACCTTCCCCTGAAGACAATGTCTATTTCGGAACTACTAGTGACGATTCGGATATTGTTACACTTGAACCA

CCTAAGCTGGAAGAAATGGGGAACCAGGAAGTTACAATTCAAGAAGCGCCCAGCTCAGATGACCTTAACATGGGCTCTTCCTCCAGCAGCCAGTACGCCT

TCTGCCAGCCAGAACCCG TCTTTTCATCTCAGCCTAGTGATGAGGAATCCAGTAGCGATGACACCAGCCACGAGCCCAGCCCTGCTCCTAGACGGCGCC

GCAACAGGAAGAAGACCGTTTCTATCTCAGAGTCTGAGGAGCCTCCACTCGCTGAGCCGGAAGATGAGCCCTCCAAGGAGCCAAGTAAACGCCACTTTAG

TCGTGGTCTCAACAAGTGTGTTATCCTGGCCTTGGTGATTGCTGTCAGCATGGGATTTGGACATTTCTATG GCACAATCCAGATTCAGAAGCAGTTAGT

CAGAAAGACCCACGAAGATGAGCTGGATGGTGTGAAGGGTTATCTCTCACAGCGCAAGCAGGAACAAGAGTCTTTTCTAGATTTCAAG TCGCTGAAAGA

AAACCTTGAGAGGTGTTGGACCGTTACTGAATCAGAGAAGATTACCTTTGAAACTCAGAAGAAGAACCTTGCTGCAGAAAACCAGTATTTACGAATATCT

CTGGAGAAGGAAGAACAAGCCCTGTCTTCATTACAGGAAGAGCTACGGCAACTAAGGGAGCAGATTAGATTGTTGGAGGATAAAGGCACAAGCACGCAGT

TAGTTAGGGAGAACCAGGTCCTTAAGCAGTACTTAGAAGTGGAAAAGCAGAAAACAGATAGCTTCCTTAGGGAAAGGGAGATGCTCTTGGAGGAGGCAAG

GATGCTGAAAAGGGACCTGGAGAGGGAACAGCTCACAGCCATGGCTCTGCGGGCAGAACTTGAGCAGTTCATCCCTGGCCAGGCACAGAGCCGTGCGGAG

TCTCCTAGTGTGCAGACTGAAGAGAAGGAAGTGGGGCTGTTACAGCAGAGGCTGGCTGAGCTGGAGCAGAAGCTCATCTTTGAGCAGCAGCGCTCGGATT

TGTGGGAGAGACTGTACGTTGAGGCAAAGGATCAACATGGAAAGCAGGAGACAGACGGGAGGAAGAGAGGAAGCAGAGGAAGCCACAGGGCGAAGAGCAA

GTCGAAGGAGACATTTCTGGGGACAGTTAAGGAAACATTTGATGCTATGAAGAATTCTACCAAGGAGTTTGTGAGACATCATAAAGAAAAAATCAAGCAG

GCGAAAGAAGCTGTGAAGGAGAATCTGAAAAAATTCTCAGATTCAGTCAAATCCACTTTTCGCCATTTCAAAGATACTACCAAGAATATCTTTGATGAAA

AGGGCAGCAAGAGATTCAGGGCTCCAAAAGAAGCGGCAACTGAAAAGACAAGAACAGCTTATAGTTATTCCTCATACTCACAGCAGGAGGCACCAAACCA

AAACCAGAATTGCAGGCGCCCTTCTGCACAGAGGGATGGAGGGAGAGAAAAGCCCAGTCACTCTGAAGAAATTAGAAAGAATGCAAATTCATATACATAC

AAGGCCAAGTCTGACTGCAGAGGCACCCATTCCACCAGAAGGGTTTGTTCAGGTATGTTTGAATGTGCTGGACAGGAAGCCATTAGCCCTGTTAATAAGG

CGAGTCCTGTTAGGATGAATGACTTCAAACAGCTGATTCACTGGTACTTACTCAATGAACTGGAGACTTTTCACCACTGGAAAGAACTGGATCAGTTTAT

CAGTCCGTTTTTTCCGAATGGTGTCTTTAGACATGACCAGCAGCTCTTCGCCGACTTTGTTGATGATGTGAAAGGTTACCTTAAGAGCATAAAGGAGTAT

CGAGTAGAGGATGGCAATCTGGAGAAGTTGGACGGATGTATATATAGACACTTTGGGCATGTTTTTGCCCTGCCATTCGGACCCAG TCGACCTGATAAA

AAGCAACGTATGGTAACTATTGAAAACGCCAGGCACCGAAAACAAGAGCAGAAGCACCTTCATCCACAGCCTTATGAAAGGGAAGGTAAATGGCAAAAAT

ACGGTCGCGCTAACGGAAGACACACGGCAAATCTTGAGCTAGAACTGGGGCAGTTACCTTTCGATCCTAAGTACTGATTTGTGATTAAGTTAGGAAGTTA

AGAGCTGTGGATGCTATCTACTTGGTTTGATGTTGAGATGAACTCCCCATGACTGTCTTTATATTATGCAAAAGCAAAGCTTACTAACTTGCATTTTCCT

GTAGCTTAGGTTTGTTAAAAACAAAAACTTTTTTTCCTGCTGGGGGGGGGTGGGGGAAATGGTAGTTTTATTAAGGAAGCCAGGCATGAAATAGTCTGTG

CATGAAACAGGGCTTGGTTTGAGGAGCTGAGCTCAGCTCACACAGGCATTTCGTGCCGTGTGGAGGTGTGCAGCAGGGCCTGAGGACTGTGCTGAGGCGG

GACTCCGCGCTAACATCTCTACTCTCACGCTTTTGTCTCTCTGTGGGTTCAAGAGCCCGTTGGTTTGTGAAGAGCTGGCTGGCTTGTCTTGTGAACTCTC

TTGCACACCTGAATGCTATGGAAGAAACAATAAACTGCACCGTGAGG
Translation
 - UNI17235 - MSESSSDSDSSCGWTVINHE - UNI21882 - GSDIEIVNSATASDNCGLTLECSLVEQEELPVLYVGHGGEE - UNI23303

 - ESSANNTSSVGETMLSSMRETKSAAE - UNI21523 - VEEAPSPEDNVYFGTTSDDSDIVTLEPPKLEEMGNQEVTIQEAPSSDDLNMGSSSSS

QYAFCQPEPV VFSSQPSDEESSSDDTSHEPSPAPRRRRNRKKTVSISESEEPPLAEPEDEPSKEPSKRHFSRGLNKCVILALVIAVSMGFGHFYG GTI

QIQKQLVRKTHEDELDGVKGYLSQRKQEQESFLDFK SLKENLERCWTVTESEKITFETQKKNLAAENQYLRISLEKEEQALSSLQEELRQLREQIRLLE

DKGTSTQLVRENQVLKQYLEVEKQKTDSFLREREMLLEEARMLKRDLEREQLTAMALRAELEQFIPGQAQSRAESPSVQTEEKEVGLLQQRLAELEQKLI

FEQQRSDLWERLYVEAKDQHGKQETDGRKRGSRGSHRAKSKSKETFLGTVKETFDAMKNSTKEFVRHHKEKIKQAKEAVKENLKKFSDSVKSTFRHFKDT

TKNIFDEKGSKRFRAPKEAATEKTRTAYSYSSYSQQEAPNQNQNCRRPSAQRDGGREKPSHSEEIRKNANSYTYKAKSDCRGTHSTRRVCSGMFECAGQE

AISPVNKASPVRMNDFKQLIHWYLLNELETFHHWKELDQFISPFFPNGVFRHDQQLFADFVDDVKGYLKSIKEYRVEDGNLEKLDGCIYRHFGHVFALPF

GPS SRPDKKQRMVTIENARHRKQEQKHLHPQPYEREGKWQKYGRANGRHTANLELELGQLPFDPKY

For any suggestions or comments, please send an email to unitrap@crg.es