Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034614 (Pik3ip1)
Chromosomal location
Chr 11: 3230793 - 3242973 (+)
Description
phosphoinositide-3-kinase interacting protein 1 Gene [Source:MGI (curated);Acc:Pik3ip1-001]
RefSeq_dna
NM_178149 
RefSeq_peptide
NP_835362.2 
UniGene
Mm.390323 
MGI
MGI:1917016 
Uniprot/SWISSPROT
Q7TMJ8 
Human Ortholog
ENSG00000100100 (PIK3IP1)
Omim not available
UniTrap UNI26373
Vector Insertion
Chr 11: 3231008 - 3231917
Public Clones not available
Private Clones OST122686 (lexicon)
Severity of mutation (?) Insertion after 11% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14188
Vector Insertion
Chr 11: 3232232 - 3233211
Public Clones CMHD-GT_1A8-3 (cmhd)
Private Clones OST388801 (lexicon)
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13104
Vector Insertion
Chr 11: 3233968 - 3241525
Public Clones CMHD-GT_326E11-3 (cmhd) CMHD-GT_439D4-3 (cmhd) CMHD-GT_489B7-3 (cmhd) CMHD-GT_314H08-3 (cmhd)
CMHD-GT_391G12-3 (cmhd) CMHD-GT_485H1-3 (cmhd) FHCRC-GT-S18-3D1 (fhcrc) IST12229B5 (tigm)
IST12124B3 (tigm) IST14161C7 (tigm) IST12963C7 (tigm) IST13309D3 (tigm)
Private Clones OST235800 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093399
Sequence
TTTACCAGAAGAGCATAACAGGGGCCGGCCAGTCTGACTGCAAGGAGACAAAACTGCTGCCAAGGAGGACCCCCCCCCCCCATTTGGACACTGGCTGTTG

AGTCACCTGCGAGCCGAAGAGACGAGGATGCTGTTGGCTTGGGTACACACATTTCTTCTCAGCAACATGCTTCTGGCAGAAGCCTATGGATCTGGAG - 

UNI26373 - GCTGCTTCTGGGACAACGGCCACCTGTACCGGGAGGACCAGCCCTCGCCCGCGCCGGGTCTCCGCTGCCTCAACTGGTTGGCCGCGCAA

GGCAGCCGCGAGTCGCTCACCGAGCCCA GCCCGGGCAACCACAACTACTGCCGGAACCCGGACCAGGACCCGCGCGGGCCCTGGTGCTACATCAGCAGC

GAGACCGGCGTCCCTGAAAAGCGGCCCTGCGAGGACGTGAGTTGCCCAG - UNI14188 - AGACCACTTCCCAAGCACCACCGCCATCCTCTGCCAT

GGAGCTGGAAGAGAAGTCTGGTGCACCAGGTGACAAAGAGGCACAGGTGTTCCCTCCTGCTAACGCCCTACCAGCCAGGAGTGAGGCAGCCGAGGTGCAG

CCAGTGATCGGGATCAGTCAGCTTGTGAGGATGAACTCCAAGGAAAAAAAAGACCTAGGAACTCTGG GCTACGTGCTGGGCATTACTATGATGGTGATC

ATCCTCGCTATTGGAGCTGGCATTATCGTGGGCTACACTTACAAGAGGTGGGTCCTTTCTCCTCCTGGATCTCTCGGGATAGGGCTAAGGAAGACATGAA

AACAATATCACATCAGCTTCTTGGCGTCTTTCAAAAGGAAGTAAGGCATTGAATCAAAATCAGCTCAATAGTAGAGATTTGGTTTTAGTCACTGCCTGGT

GATCTTGGGCCCTCAGGGCAAGGAATCCTCCTGTCTCAACCTCTTGGAAAATGGGATTTCTGAGCCCTTGTCATCATGCTCCGAAGGAAAAGAGATTCAT

TTTGTTGAGTTTTAAAATTTTGCTACTAAGATAGGTGTCCTGCTTCATACATACTCTAATCCCAGAACTCAGGAGACTGAGGCAGGAGGTTTACAAGTTT

GGAAACTGAGGCTCTGTTTCAAAAAGAC
Translation
MLLAWVHTFLLSNMLLAEAYGSGG - UNI26373 - GCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPS SPGNHNYCRNPDQDPRGPWCY

ISSETGVPEKRPCEDVSCPE - UNI14188 - ETTSQAPPPSSAMELEEKSGAPGDKEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLG

TLG GYVLGITMMVIILAIGAGIIVGYTYKRWVLSPPGSLGIGLRKT
Transcript ENSMUST00000045153
Sequence
AGTTCTAAAGAGAGGCTGTTTACCAGAAGAGCATAACAGGGGCCGGCCAGTCTGACTGCAAGGAGACAAAACTGCTGCCAAGGAGGACCCCCCCCCCCCA

TTTGGACACTGGCTGTTGAGTCACCTGCGAGCCGAAGAGACGAGGATGCTGTTGGCTTGGGTACACACATTTCTTCTCAGCAACATGCTTCTGGCAGAAG

CCTATGGATCTGGAG - UNI26373 - GCTGCTTCTGGGACAACGGCCACCTGTACCGGGAGGACCAGCCCTCGCCCGCGCCGGGTCTCCGCTGCCTC

AACTGGTTGGCCGCGCAAGGCAGCCGCGAGTCGCTCACCGAGCCCA GCCCGGGCAACCACAACTACTGCCGGAACCCGGACCAGGACCCGCGCGGGCCC

TGGTGCTACATCAGCAGCGAGACCGGCGTCCCTGAAAAGCGGCCCTGCGAGGACGTGAGTTGCCCAG - UNI14188 - AGACCACTTCCCAAGCACC

ACCGCCATCCTCTGCCATGGAGCTGGAAGAGAAGTCTGGTGCACCAGGTGACAAAGAGGCACAGGTGTTCCCTCCTGCTAACGCCCTACCAGCCAGGAGT

GAGGCAGCCGAGGTGCAGCCAGTGATCGGGATCAGTCAGCTTGTGAGGATGAACTCCAAGGAAAAAAAAGACCTAGGAACTCTGG GCTACGTGCTGGGC

ATTACTATGATGGTGATCATCCTCGCTATTGGAGCTGGCATTATCGTGGGCTACACTTACAAGAG - UNI13104 - GGGGAAGGACTTGAAAGAGCA

ACATGAGAAGAAAGCGTGTGAGAGGGAGATGCAGCGAATCACCTTGCCCCTGTCTGCCTTCACAAACCCCACCTGTGAGACCGTGGATGAAAACACCATC

ATTGTGCACAGCAACCAGACTCCTGCTGACGTGCAGGAGGGCAGCACCCTCCTCACGGGCCAGGCTGGCACCCCTGGGGCCTGAGCCCCTTCAGTGGGCA

GGTGCCCATGTAAACACTGGTACAGGACAGGCCACCCTCCTGCAGTTGGGAGGAGCTACATTTTGTGTTGTGGTTAAAACCTTATCCCATTTTTCTTTTG

GGGGGAATGTGACTCCTCATGACACAAGAAGATGCAGGTAGCATTATGGGTGAGGGTGAGGAGGCTGGGTAGGGTCCTATCAACGCTCCTTTTCTATCCC

TTGGAGCAGAATTTGCCTGCGGAGAGAGACTGGCACAGTAGCCACAGTGGTGCTGTGGCAAATAAGGGCTTCCACATTGCCTGGGCCAAGGAAAGACTGG

GAGCTGGCTAAAGCTCTTCTGTCCTGTATACTGAAGAAGGTGGCCTCAGTCTCTGCTTTTCCATTCGTCATCCAGGAACTTGAGTGGCATATACTGTTAT

TCCTAGTTAAGGTCAAGCATAAAAAAAACTATATATATATAAATGAAAGAAATATTTAGGATGAAAGTCCCTTCTGACTTCTAAGAACCTGAAATGAATC

TGCTTGCTGGCAGCGATGTGCCTTGACAACTGTGGGATAGGCCTGGGCCCGAGGGTCTCTTCCTATCTCGTAAGGAAAGGGAAGAATTGCACTAAACTTT

CCACTTAGGTGAAGGACCCGCTTCTGCCTTCAGCCTCATGCAGCAGACCAGAATATCCAGACTGTCTTTTGGGGGCTGGATAGAGGAACCTCTCAATTTT

GCGCTGATAAGAAAATAGCCAATTCATGGGAATTACACACTTGAGAGTGTGGTGACCCGCAGCTGAAAGGTGAGCTTGGAGACCAAGCCAGAAGGTTGGT

AACATGCTGGGGCTTGCGTTGTAGTCCTGCCGGGCTTGCAGGCCAGTTCCTTCCATAGGGTTAAGATTAACTGGTACAAAACAATCACTGCACCACTGCG

AAAGACCTGAAGGAGTTCCAGAAAGGGCAAAGCAGCTTCCCAGTGTCCTCCTGGCCTTGGCAGTGTCCCCAGCCAGGAGCCCTTCCACTCCCAACACTGG

GAGCAGGCTTCACCAGGCTGCTCTCATAAGCCATTTGTTGAGGGGGCCTGGATCTCAGGGTTCCCATGGTGGTGGTGACTGTGGGAAGAGAGCAGTACTA

CTTCCTACTTTCCTATGAAAGTATTTCTCTGTATGTTTTATATACCTCATTCTGACACCTGTGTATGAACTATGGCAATTTGTTTTGCTTTTGACTTATA

TAAACACAAGACATGGTTTTACCTTGC
Translation
MLLAWVHTFLLSNMLLAEAYGSGG - UNI26373 - GCFWDNGHLYREDQPSPAPGLRCLNWLAAQGSRESLTEPS SPGNHNYCRNPDQDPRGPWCY

ISSETGVPEKRPCEDVSCPE - UNI14188 - ETTSQAPPPSSAMELEEKSGAPGDKEAQVFPPANALPARSEAAEVQPVIGISQLVRMNSKEKKDLG

TLG GYVLGITMMVIILAIGAGIIVGYTYKR - UNI13104 - RGKDLKEQHEKKACEREMQRITLPLSAFTNPTCETVDENTIIVHSNQTPADVQEG

STLLTGQAGTPGA

For any suggestions or comments, please send an email to unitrap@crg.es