Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034667 (Xpot)
Chromosomal location
Chr 10: 121024436 - 121063372 (-)
Description
exportin, tRNA (nuclear export receptor for tRNAs) Gene [Source:MGI Symbol;Acc:MGI:1920442]
RefSeq_peptide
NP_001074525.1 
UniGene
Mm.25042 Mm.413364 Mm.462981 
MGI
MGI:1920442 
Uniprot/SWISSPROT
Q9CRT8 
Human Ortholog
ENSG00000184575 (XPOT)
Omim not available
UniTrap UNI20573
Vector Insertion
Chr 10: 121060048 - 121063160
Public Clones (sanger) 5SD171F11 (ggtc)
Private Clones OST358302 (lexicon) OST192120 (lexicon) OST62887 (lexicon) OST36542 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2941
Vector Insertion
Chr 10: 121056232 - 121059913
Public Clones AD0132 (sanger) AN0745 (sanger) AM0891 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27804
Vector Insertion
Chr 10: 121053741 - 121054187
Public Clones not available
Private Clones OST47651 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9957
Vector Insertion
Chr 10: 121052280 - 121053670
Public Clones XC420 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 9% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1716
Vector Insertion
Chr 10: 121048769 - 121050278
Public Clones CG0724 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9536
Vector Insertion
Chr 10: 121044692 - 121046179
Public Clones XE360 (baygenomics) CMHD-GT_259C8-3 (cmhd)
Private Clones not available
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12485
Vector Insertion
Chr 10: 121043897 - 121044054
Public Clones W093B05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI14
Vector Insertion
Chr 10: 121039477 - 121040084
Public Clones GC0253 (tigem) RRT203 (baygenomics) RRR005 (baygenomics) A036A03 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 78% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039810
Sequence
CCGCTCCGCGCCACGCAAGAGAAGGCGCCCGGGGAACGCCGAGCGCCGAGAGGAGCGCGGCCCGGGCCGGCTCCGGCGCTAGCGCTGCGGCTGTATTGGA

GGACTACAGCGACAAGGACGTGGGCCGCTCTCCGTGCTCCCTGCGTACGGCCCGCTCCTTGCGGCTGGCCGACCCTCGGGAGTGCAGGCGAGGAAGAGAT

ATTGGAGTGATG - UNI20573 - ATGATTGTGGATTCTGCTGTGGGATTAGAAGCCACGTCTGTTGTGATCGGAAAACTCCAGGAATAGCGGCCGAG

ATGGATGAACAGGCTCTTTTAGGGTTAAATCCAAATGCCGATTCAGACTTTAGACAGAGG - UNI2941 - GCCCTGGCTTATTTTGAGCAGTTAAAG

ATTTCCCCAGATGCCTGGCAGGTGTGTGCAGAGGCTCTGGCACAGAAGACATACAG TGATGACCACGTAAAGTTCTTCTGCTTCCAAGTACTAGAGCAT

CAAGTTAAATACAA - UNI27804 - GTACTCAGAACTAAGCACTGCTCAGCAGCAGCTCATCAGGGAGACACTGCTCTCATGGCTTCAGGCTCAG -

 UNI9957 - ATGCAGAATCCGCAGCCAGAGAAGACCTTCATACGGAACAAAGCGGCCCAAGTGTTCGCCTTGCTTTTTGTTACAGAGTATCTCACTAA

GTGGCCCAAGTTTTTTTTTGACATCCTCTCAGTTGTGGACCTAAACCCGAGGGGCGTGGACCTGTACCTGCGGATCCTCATGGCCATCGATTCAGAGCTG

GTGGATCGGGACGTGGTTCACACGTCAGAGGCAAGTGGCTTGGA GAACACACTGATAAAAGACACCATGCGGGAGCAGTGCATTCCAAATCTGGTGGAA

TCGTGGTACCAGATTTTACACAACTACCAGTATACGAATTCAGAAGTGCTGTGCCAGTGCCTTGAAGTAGTTGGGGCCTACGTCTCCTGGATAGACTTAT

CCCTTATAGCCAATGATAG GTTTATAAATATGCTGCTAGGTCACATGTCCGTAGAGGTTCTACGGGAAGAAGCATGTGACTGCTTGTTCGAGATTGTAA

ATAAAGGGATGGACCCTGTGGATAAGATGAAACTCGTAGAGTCCCTGTGTCAAGTATTACAGACTGCTGGGTTTTTCAGCATTGACCAG - UNI1716 

- GAAGAAGATTTGGACTTCGTGGCCAGATTTTCTAAGCTGGTAAATGGAATGGGACAGTCGTTAATAGTTAGCTGGACTAAATTAATTAAGAATGGGGC

TGTCAAGAATGCGCAGGAGGCACTGGAAGCTATTGAGACAAAAGTGCCACTTATGTTACAGCTGCTAGTTCACGAGGACGATGACATTTCCTCCAACATC

ATTGGGTTTTGTTATGATTATCTCCATATCCTGAAACAG CTTCCTGTGCTCTCGGATCAGCAAAAAGCTAATGTAGAG GCAATCATGTTGGCCGTTAT

GAAAAAATTGACTTATGATGAAGAATATAACTTTGAAAATGAG - UNI9536 - GGTGAAGATGAAGCCATGTTTGTAGAATACAGAAAACAGCTGAA

GTTACTGTTGGACAGACTTGCTCAGGTGTCCCCGGAGCTCGTGCTGGCTTCTGTTCGCAGGGTCTTCAGTGCCACGCTGCA GAACTGGCAGACCACGCG

CTTCATGGAGGTTGAAGTAGCCGTGCGGTTGCTGTACATGCTGGCGGAAGCTCTCCCGGTGTCCCACGGCGCTCACTTCTCAGGTGACGTGTCAAAAGCG

AGTGCTTTGCAGGACATGATGCGGACG - UNI12485 - CTGGTGACATCAGGAGTCAGCTCCTACCAGCACACGTCTGTGACCCTGGAGTTCTTTGA

AACTGTTGTTCGCTATGAGAAGTTTTTCACAGTTGAACCTCAGCACATTCCGTGTGTACTC ATGGCTTTCTTAGATCACAGAGGTCTGTGGCATTCCAG

TGCTAAAGTCCGGAGCAGAACCGCCTACCTGTTTTCTAGATTTGTCAAATCTCTCAA TAAACAAATGAATCCTTACATTGAGGAGATTTTGAATAGAAT

ACAGGATTTATTAGCCCTTTCTCCACCG GAGAACGGATACCAGTCCTTGCTGAGTAGCGACGATCAGCTCTTCATTTACGAAACGGCCGGGGCGCTGAT

TGTTAACAGTGAATACCCCGCAGAAAATAAGCAGGCCTTAATGAAGGACCTCCTGACACCACTGATGGAGAGGTTCAAGGTTCTGTTGGAAAAGCTGATG

ATGGCGCAGGATGAAGAGAGACAAGCATCTCTTGCAGACAGTCTCAACCACGCAGTGGGATTCGCCAG TCGAACCAGCAAGGCCTTCAGCAACAAGCAG

ACTGTGAAACAGTGCGGCTGCTCCCAGGTCTACCTGGACTGCTTACAGACCTTCCTGCCAGCCCTCAGCTGCCCCTTGCAAAAGGACGTCCTCCGAAGTG

GTGTGCGGACCTTCCTCCATCGGATGATCATCTGCCTCGAGGAGGAGGTGCTCCCGTTCATCCCGTCGGCCTCGGAGCACATGCTCAAGGACTGTGAGGC

GAAAGACCTCCAGGAGTTCATCCCACTCATCAACCAGATCACGGCCAAGTTCAAG - UNI14 - ATGCAGGTGTCCCCGTTTTTACAGCAGATGTTCA

TGCCCCTGCTTCACGCTATCTTCGAAGTGCTGCTGCGACCAGCGGAAGACAACGACCAGTCGGCCGCGTTGGAGAAGCAGATGCTGAGGAGGAGTTACTT

CGCCTTCCTGCAGACGGTCACCGGCAGCGGGATGAGTGAAGTGATCGCGAATCAAG GTGCAGAAAATGTAGAGCAGGTGCTGGTTACTATTATCCAAGG

AGCCGTTGACTATCCAGATCCGATTGCACAGAAAACGTGTTTTATTATCCTCTCAAAGCTGGTGGAGCTCTGGG GAGGCAAGGACGGACCGGTGGGCTT

TGCCGACTTTGTTTATAAGCACATCGTCCCAGCGTGTTTCCTGGCACCTTTGAAGCAGACCTTTGACCTGGCAGATGCACAGACAGTATTG GCGCTTTC

TGAGTGTGCCGTGACTCTGAAAACAATCCATCTCAAACGG GGCCCTGAGTGTGTTCAGTATCTTCAACAAGAATATCTGCCCTCCCTACAAGTTGCTCC

AGAAATAATTCAG GAGTTCTGTCAAGCACTTCAGCAGCCTGATGCTAAAGTTTTTAAAAATTACCTAAAG GTGTTCTTCCAGAGAGCAAAACCCTAAG

GACTGGACCTCCCGGCCCCTGTCATGATCAGGAACTCCAGTTCATAATTTATAAAGAAGCAGTTTGTGTGTGTGTGGGTGTGTGTGTGCTCGCGAGCGCC

ATCCACACTGGTCCTTTAGCATTGTTTCCATCATATTGCAGTGTATGTGGGATTTTCTGTAAAATGGGTGTAATTTTTCCCTTAAAAAGGTGTGTGACAA

CAAGAGAAGTTGCCTGCATGCCGGTTTAAATTGTTTATGTAAAAATGCTGTTATAAGACATAGATTTATCCTAGTTCCTTAATTTTTTTTCCTTTTATGA

AACTTTAAAGTTCTTTATAAAATGCAGCAGTGGAAAACTGACTAACAAATCGAATGTAAAGTTGGGAATGTTTGGTTCTGTGTATGCAGACACATGAGCT

GTGGGGTAACAATCAAAACGTAATCTTTCATAGATAGCCATTACATTTCTTTAAATTTTTCAATGCCGATGTGTATTCTATAAGAGAATAGCTTCCTAAT

TAAGTCGGTTTAGAAGAAGGTGCTGGTGTCACACATTTTTTTATAAAAAATAAATTTTACATAGTGAAATACACCAAGTCTTTTCCGGAGTTATTACAAA

GAGCCTCCTTTCCCCACCTTACTCACACTGATTCCCACCTAACAATCAGCAGATGGGAGTGTGGGTTCCTTATGTCACAGGCTGTGCCCCAGCGGTCACT

CACAACATAGGTCTGTTGAGTCTTTTTTAAATGCACTAGGAGCCAACTCTGTCCATCTGTGATGGGATTAGAAAGCCCGGTGTTTTTCTGTGATATTAGA

TGTCCTCCGAGCACAGCCCACTTGGATTTGTTTGTTTGGTTTTGCCTTGAGACTGGGTCTCACTATACAGAGCAGCCTGCCTCCCCACTGCTGGGATTAA

GCTGAGAAGCACCAAGTCTGACCACCCGTGTGTTGATGACTTGCAGTCAATTAACTATGTGTGCTGCTTCGTGCAACAGGAGAAAGCCAGAAGAGCAGCC

TCGGGAAAGACAGACGGAAGTCCGGCAACCCAGCTGTAGGCGCTTACACTGAAATCTAAGTCTGTATAGTGAACGCCAGCGGCGGCCGACTTCTATCCCA

AGCACTGCGCAAAAGCAGAGGAACGGAAAGGGAAAGGGCCAGGTCATCCTCAGCCACATAGTGAGTCCAAGGTCGGCCTGGACTGCACGAGAGTCTGTCT

AGGAATGCAGTTAGTAAAAGCCTGGCGTCTACTGCAGAGTATGTATACTTGGTGGTAGAGGGCTTGCTTGAAGACCCAAGTTCCATCCCTAGCACCACAG

AGCAGGGAGGGGACACAGATTTAGGAGAGATTTGTCTTTTTCTCCTTTGGCTGTGTGTTGTCCAGGGATATATATTTCCTAAAATCTTTTTAAAGTGAAT

TTATATGTGCACATATGTGTGTGTAGGGGGAGGATAAGAACTGAATTATTTGAAACAGGTTATTATTTGAAACTGTATTACTCTACTCAGTATTTTGGCC

AGGTCCCAGTCCCGGGTTGCAGGTGTTGACTGCCACCAAGGTTTGATACGGGATCCAAATTCAGGCCCCCATCTCGTCCATCGAGCACTTTGTGAACTTG

AACCCACGCCCCCCCCCCCCCAATCCCCTAGAATCTTTTTCTGATTTTTAACTCCAGGAGAGATAGCATTTTCCTTACATTATAAAATAAAAGCAGTGAA

GTAAATTGACAGCTAAGGATCTCTATTTCATCTCTTGAACGATGAAAATAGTGACGTATATATAGTACTTCTATAAATAACAGTTTTTAAGAAATAGGTA

AGTGGGGCAGGTTTGGTGGCTTCTGCCTGTAATCACTGCATTCAGAGGGGGCCAAGGCCTGTTTCAAAAACAACAACCAAGACAAGCAAAACCAGGTGTT

GCTTTGCTATGTTCCTGTACACTGTGGGAGAGGTAATAGCATCTGTGGGACACAGCAGAATTGTACAAGTGTACAATTAGTGTGTAGCAGAGCACAGCAG

TTACGAGCTTGTATAACGAGGACTCTGGATCCAGATTTAAGTAGATTCAAACACCACTTAACACCAGTAACCGATTTTAGGACCTTGAGCAAGTTAAATA

ACTTCTTCCTGCCTTGGTTTCCCCGTCAGAAATGGGGAACAGTGGTAGCTACCTCATAACTTGTAAAGAATCCAATGAATTAAAACACAGGTCTCAGTAT

TAGCTTGTATTACTGTACTATCGAGTCCATACACGGCTCTCTAAAGCCCTACAGAGGGTTCATGTGTTTAGACCTGAGAAATCAGGACATGGAAATCAGA

GCATATACATAAGGAACTTAATTTTAATGTAATCATGTCTAATGATCCTCATCTTCATTCCTTGAGATTACCCAAGTACCGTCATGACCAAGAAGCCTTT

CCGTCATTGAGTACCTGATTTTTAAAAGCAAGCACCCAAATAATTCTCTCTAGGGAATCTCATTTGTTACAGGTGAGAAGACAGAGGGTTTTATGGTGCC

TGAGTTAGTCCTGTGCCTAACCAGTGGAGTTTCCGTCTCTGTGCTTGCTAATAGTTTCACAAGTGGCTTGACTTTTTTAGAAGTATTATGTGGTATTTTA

CTGTGTATCACTTCTGTGGTAAACATGTGAAGTCCTTTGGCTTAGTCATACTTCATAACTTTTGAACGTTGGGTTTTTTGTTGGAAGAAACTTGGATGAA

TCTGTCATGTCATTAACAGAACTGAAATATTCTATTGTAAGACGTGCATTTGCGGTTAGAATGGTCTTGTTGCCTAAACTGTCTAAAATTCTAATAAAAT

AACTTTCTAAGAA
Translation
 - UNI20573 - MDEQALLGLNPNADSDFRQR - UNI2941 - ALAYFEQLKISPDAWQVCAEALAQKTYS SDDHVKFFCFQVLEHQVKYK - U

NI27804 - KYSELSTAQQQLIRETLLSWLQAQ - UNI9957 - MQNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYL

RILMAIDSELVDRDVVHTSEASGLE ENTLIKDTMREQCIPNLVESWYQILHNYQYTNSEVLCQCLEVVGAYVSWIDLSLIANDR RFINMLLGHMSVEV

LREEACDCLFEIVNKGMDPVDKMKLVESLCQVLQTAGFFSIDQ - UNI1716 - EEDLDFVARFSKLVNGMGQSLIVSWTKLIKNGAVKNAQEALEAI

ETKVPLMLQLLVHEDDDISSNIIGFCYDYLHILKQ LPVLSDQQKANVE AIMLAVMKKLTYDEEYNFENE - UNI9536 - GEDEAMFVEYRKQLKL

LLDRLAQVSPELVLASVRRVFSATLQ QNWQTTRFMEVEVAVRLLYMLAEALPVSHGAHFSGDVSKASALQDMMRT - UNI12485 - LVTSGVSSYQ

HTSVTLEFFETVVRYEKFFTVEPQHIPCVL MAFLDHRGLWHSSAKVRSRTAYLFSRFVKSLN NKQMNPYIEEILNRIQDLLALSPP ENGYQSLLSSD

DQLFIYETAGALIVNSEYPAENKQALMKDLLTPLMERFKVLLEKLMMAQDEERQASLADSLNHAVGFAS SRTSKAFSNKQTVKQCGCSQVYLDCLQTFL

PALSCPLQKDVLRSGVRTFLHRMIICLEEEVLPFIPSASEHMLKDCEAKDLQEFIPLINQITAKFK - UNI14 - MQVSPFLQQMFMPLLHAIFEVLL

RPAEDNDQSAALEKQMLRRSYFAFLQTVTGSGMSEVIANQG GAENVEQVLVTIIQGAVDYPDPIAQKTCFIILSKLVELWG GGKDGPVGFADFVYKHI

VPACFLAPLKQTFDLADAQTVL ALSECAVTLKTIHLKR GPECVQYLQQEYLPSLQVAPEIIQ EFCQALQQPDAKVFKNYLK VFFQRAKP

For any suggestions or comments, please send an email to unitrap@crg.es