Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034714 (Ttyh2)
Chromosomal location
Chr 11: 114536831 - 114582289 (+)
Description
tweety homolog 2 (Drosophila) Gene [Source:MGI (curated);Acc:Ttyh2-001]
RefSeq_dna
NM_053273 
RefSeq_peptide
NP_444503.2 
UniGene
Mm.271934 Mm.475167 
MGI
MGI:2157091 
Uniprot/SWISSPROT
Q3TH73 
Human Ortholog
ENSG00000141540 (TTYH2)
Omim not available
UniTrap UNI20198
Vector Insertion
Chr 11: 114536987 - 114547707
Public Clones not available
Private Clones OST369748 (lexicon) OST204067 (lexicon)
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25927
Vector Insertion
Chr 11: 114551665 - 114557902
Public Clones not available
Private Clones OST150623 (lexicon)
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28026
Vector Insertion
Chr 11: 114573153 - 114580442
Public Clones not available
Private Clones OST42142 (lexicon)
Severity of mutation (?) Insertion after 96% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000045779
Sequence
GTGGACCCGCTGCAGCTTGTGCAAGCCATGCCGGCGGCGCGAGTGGAGTACATCGCGCCCTGGTGGGTCGTGTGGCTGCACAGCGTTCCGCACCTCGGCC

TGCGCCTGCAGCGAGTAGACAGCACCTTCAGCCCCGGCGACGAAACTTACCAGGAG - UNI20198 - TCGCTGCTCTTCCTGGGGGTGTTGGCTGCC

ATTGGCCTGGGCCTGAATCTCATCTTCCTCACCGTCTACCTGGTGTGCACATGCTGCTGCCGGCGGGACCACACGGTGCAGACCAAGCAGCAGGAATCAT

GCTGCGTGACCTGGACGGCGGTGGTGGCTGGGCTCCTCTGCTG TGCTGCGGTGGGCGTTGGTTTCTATGGAAACAGCGAGACCAACGATGGGATGCATC

AGCTGATCTACTCCCTGGACAACGCGAACCACACCTTCTCTGGAATGGATGAGCTG - UNI25927 - GTGTCTGCAAACACCCAGAGGATGAAGGTA

GACCTAGAACAGCACCTGGCCCGGCTCAGCGAGATCATTGCTGCCCGGGGTGACTACATCCAGACCCTGAAGTTTATGCAACAGATGGCAGGCAATGTCG

TCAGCCAGCTCTCGGGGCTGCCCGTGTGGAGGGAGGTCACCACGCAGCTGACCAAGCTGTCCCACCAGACTGCCTATGTGGAATACTACAG GTGGCTGT

CCTACCTCCTGCTTTTCATCCTTGACCTGGTCATCTGCCTTGTCACCTGCCTGGGACTGGCCAGGCGGTCCAAGTGTCTCCTAGCCTC CATGCTGTGCT

GTGGAATACTGACCCTGATCCTCAGCTGGGCTTCTCTGGCTGCTGATGCTGCTGCAGCAGTG GGCACCAGTGACTTCTGCATGGCTCCTGACATCTACA

TCCTGAACAACACAGGGAGCCAGATCAACTCAG AGGTGACCCGGTACTACCTCCATTGCAGTCAGAGCCTAATCAGCCCGTTCCAGCAG TCACTGACC

ACCTTCCAGCGCTCATTGACCACCATGCAGATCCAGGTTGGAGGCCTGCTGCAGTTTGCCGTGCCCCTCTTCCCTACAGCAGAG AAAGACCTTCTTGGC

ATCCAGCTTCTGCTAAACAACTCCGAGATCAGCCTGCACCAGTTGACCGCCATGTTGGATTGCCGAGGGCTGCACAAG GACTACCTAGACGCCCTCACT

GGCATCTGCTATGATGGCATTGAGGGCCTGCTCTTCCTTGGTCTCTTCTCCCTCTTGGCTGCCCTGGCTTTCTCCACCCTGACCTGTGCCGGACCTCGTG

CCTGGAAATACTTCATCAACAG GGACAGAGATTATGATGACATCGACGACGATGACCCTTTCAACCCCCAAGCTCGGCGCATCGCGGCCCATAACCCCA

CGAGGGGGCAACTGCACAGTTTCTGCAGCTACAGCAGCGGCCTTGGCAGCCAGTGCAGCCTTCAGCCTCCCTCCCAGACCATCTCCAATGCCCCAGTCTC

TGAGTACAT GAACCAGGCCATACTCTTTGGTGGGAACCCACGATACGAAAATGTGCCACTCATCGGGAGAGGTTCCCCTCCGCCCACA - UNI28026

 - TACTCTCCCAGCATGAGACCCACCTACATGTCCGTGGCGGATGAACACCTGAGACACTACGAGTTCCCGTCCTAGGGGCTTTCAGTGTACCTGCCTC

TTCTGCCAGCTCGGTTCTCAGCAGATGCAGAACCCAGCTGTGTTTCTGGAATAGAAACCGAAGGTTCCTGGACACGAACAGGCTCCTGTGGCTGCAGAGA

CACAGCTGGGACTCCTGACCAAAGCCACAGGTGGACGTGAGGCCTGTGACTGGACCAGCCTCTCCGGCCTTAACTCCCCCAGGACTCAGCTGTTGTCCCT

GAGGCAGCTGCCCGCTTCAGCCCACCTTAAGTCCCACCCTCAGCAGATGAAAAATGGTAATTGAGGAGGGGACCACCAGCCTGAGAGCCCTTTTCTCTAA

AGGCCCTTCCATTGGGCTCCTGCCTCTTGTTAGCGTGGCCCTAACTAAGTCCAGGCCACACCCTCCAGTTACTTGGTCCTTGGTTTCTAGGCGGTGGCAA

TTGGAGGTGTGTTAGGAGAACACCTGGTCCAGGATCTACGTTCTGGGACCACAGGGACTCTGCCTAGATGCCAGAAGGACAGCATCAAGAGATCTCCCCA

GAGGGGATGGGTGGCTTCAAGCTGGGCACTGCAGCCTGGCAGCCATGGGCACAATTCTCTAACCTCCACCAGCCAACCCCATTCTGGAACCAGGTGTCAG

CTGCAGGTGGGGACAGTCTCAGGTATGAACAGACACTTTGAAAGCACCTGAACAGGTTCCCAGTGTTTTAAAACAGGTTGATGATCCAAAGACTCACGCC

TCCCGCAGGCACGGCCAATACTTGCAATAGACTCAGGCTCGGTTGGGTTTTATACCCGATGTTCTACTGTGGCTCTCACACAAGCCATCTTACAGATCTG

GAGGAGAGGCCAAGGAGTGAGCTGTGGGGTTTTTGGGGTTTTGTTTTGCTGCGGTCTCCTTATATACCCTGACTGGCCCTGGCCTAGAACTCATAGAGAT

CTGCCTGCCTCTGTCTGCAGAGTACTGGGCTCAAAGGCGTGTGCTACCACACCACACCAGGCCAGGAGCAGATTTGCTTTGATTTTTTTTTTTTTTTTTT

TTTTTTTGAGACAGGGTTTCTCTGTGTAGCCCTAGCTTGTCCTTGAACTCATTCTATAGACCAGACTAACCTCAAATTCAGAGATCACCTGCCTCTGCCT

TGAGAGTGCCAGGATTAAAGGGTGCGCCATGATGCCACATCCTGGTCTTTTGGCTTTTTTTTTTTTTTTTTAATAAGATATCAGTGAGACATTCTACCCC

ACACGGCTAGAGAAGGACATCTGGAGCCTTGTAAAGGGAAAGACATGATAGCTAAGAAGGCCGAGGGACTTCATTCTGAGGAACAGCCACTTCTGGCCAG

GAGAAAATAATAACCCCTGTCCTGCCTGCCAAGGGACAGGTTAGGGGTCTTTGGTGCTTCCAACCTCTGACCAACCCAGAGTACACTACACACCGAAGCC

CCGTGGCCTTGTGCAGCCAAGCGAGGCCCTACTGATGGTGCGGGACAGGGATGTGTCCATTTCAGAAGAGCCACATTGTCATTGTACTGGCAGCTCCCAG

CCAAGCCACCGGCGTCACTGTGTCTCATATTAACCTGTGCATACTGTGAGCGACCTTTGTATGCCTGTGTCCTGTGCAGACTCGGAGCTTTGACCTCAGG

CCTTGCTCCTGATGTCTCCTCTGCAGCAGCTGAAGGACTTTTTAATGCATGTACATTAAACTAAAACTCCTCCGGGTTCTACAAGAGTCGGGTGGGCAAA

CCTCTTCTTGATCCATGTTCGCCCTCCCCCAGAAATAAACCACTTCCCTT
Translation
MPAARVEYIAPWWVVWLHSVPHLGLRLQRVDSTFSPGDETYQE - UNI20198 - SLLFLGVLAAIGLGLNLIFLTVYLVCTCCCRRDHTVQTKQQES

CCVTWTAVVAGLLCC CAAVGVGFYGNSETNDGMHQLIYSLDNANHTFSGMDEL - UNI25927 - VSANTQRMKVDLEQHLARLSEIIAARGDYIQT

LKFMQQMAGNVVSQLSGLPVWREVTTQLTKLSHQTAYVEYYR RWLSYLLLFILDLVICLVTCLGLARRSKCLLAS SMLCCGILTLILSWASLAADAAA

AV GTSDFCMAPDIYILNNTGSQINSE EVTRYYLHCSQSLISPFQQ SLTTFQRSLTTMQIQVGGLLQFAVPLFPTAE KDLLGIQLLLNNSEISLHQL

TAMLDCRGLHK DYLDALTGICYDGIEGLLFLGLFSLLAALAFSTLTCAGPRAWKYFINR RDRDYDDIDDDDPFNPQARRIAAHNPTRGQLHSFCSYSS

GLGSQCSLQPPSQTISNAPVSEYM MNQAILFGGNPRYENVPLIGRGSPPPT - UNI28026 - YSPSMRPTYMSVADEHLRHYEFPS
Transcript ENSMUST00000100242
Sequence
GTGGACCCGCTGCAGCTTGTGCAAGCCATGCCGGCGGCGCGAGTGGAGTACATCGCGCCCTGGTGGGTCGTGTGGCTGCACAGCGTTCCGCACCTCGGCC

TGCGCCTGCAGCGAGTAGACAGCACCTTCAGCCCCGGCGACGAAACTTACCAGGAG - UNI20198 - TCGCTGCTCTTCCTGGGGGTGTTGGCTGCC

ATTGGCCTGGGCCTGAATCTCATCTTCCTCACCGTCTACCTGGTGTGCACATGCTGCTGCCGGCGGGACCACACGGTGCAGACCAAGCAGCAGGAATCAT

GCTGCGTGACCTGGACGGCGGTGGTGGCTGGGCTCCTCTGCTG TGCTGCGGTGGGCGTTGGTTTCTATGGAAACAGCGAGACCAACGATGGGATGCATC

AGCTGATCTACTCCCTGGACAACGCGAACCACACCTTCTCTGGAATGGATGAGCTG - UNI25927 - GTGTCTGCAAACACCCAGAGGATGAAGGTA

GACCTAGAACAGCACCTGGCCCGGCTCAGCGAGATCATTGCTGCCCGGGGTGACTACATCCAGACCCTGAAGTTTATGCAACAGATGGCAGGCAATGTCG

TCAGCCAGCTCTCGGGGCTGCCCGTGTGGAGGGAGGTCACCACGCAGCTGACCAAGCTGTCCCACCAGACTGCCTATGTGGAATACTACAG GTGGCTGT

CCTACCTCCTGCTTTTCATCCTTGACCTGGTCATCTGCCTTGTCACCTGCCTGGGACTGGCCAGGCGGTCCAAGTGTCTCCTAGCCTC CATGCTGTGCT

GTGGAATACTGACCCTGATCCTCAGCTGGGCTTCTCTGGCTGCTGATGCTGCTGCAGCAGTG GGCACCAGTGACTTCTGCATGGCTCCTGACATCTACA

TCCTGAACAACACAGGGAGCCAGATCAACTCAG AGGTGACCCGGTACTACCTCCATTGCAGTCAGAGCCTAATCAGCCCGTTCCAGCAG TCACTGACC

ACCTTCCAGCGCTCATTGACCACCATGCAGATCCAGGTTGGAGGCCTGCTGCAGTTTGCCGTGCCCCTCTTCCCTACAGCAGAG AAAGACCTTCTTGGC

ATCCAGCTTCTGCTAAACAACTCCGAGATCAGCCTGCACCAGTTGACCGCCATGTTGGATTGCCGAGGGCTGCACAAG GACTACCTAGACGCCCTCACT

GGCATCTGCTATGATGGCATTGAGGGCCTGCTCTTCCTTGGTCTCTTCTCCCTCTTGGCTGCCCTGGCTTTCTCCACCCTGACCTGTGCCGGACCTCGTG

CCTGGAAATACTTCATCAACAG GAACCAGGCCATACTCTTTGGTGGGAACCCACGATACGAAAATGTGCCACTCATCGGGAGAGGTTCCCCTCCGCCCA

CA - UNI28026 - TACTCTCCCAGCATGAGACCCACCTACATGTCCGTGGCGGATGAACACCTGAGACACTACGAGTTCCCGTCCTAGGGGCTTTCA

GTGTACCTGCCTCTTCTGCCAGCTCGGTTCTCAGCAGATGCAGAACCCAGCTGTGTTTCTGGAATAGAAACCGAAGGTTCCTGGACACGAACAGGCTCCT

GTGGCTGCAGAGACACAGCTGGGACTCCTGACCAAAGCCACAGGTGGACGTGAGGCCTGTGACTGGACCAGCCTCTCCGGCCTTAACTCCCCCAGGACTC

AGCTGTTGTCCCTGAGGCAGCTGCCCGCTTCAGCCCACCTTAAGTCCCACCCTCAGCAGATGAAAAATGGTAATTGAGGAGGGGACCACCAGCCTGAGAG

CCCTTTTCTCTAAAGGCCCTTCCATTGGGCTCCTGCCTCTTGTTAGCGTGGCCCTAACTAAGTCCAGGCCACACCCTCCAGTTACTTGGTCCTTGGTTTC

TAGGCGGTGGCAATTGGAGGTGTGTTAGGAGAACACCTGGTCCAGGATCTACGTTCTGGGACCACAGGGACTCTGCCTAGATGCCAGAAGGACAGCATCA

AGAGATCTCCCCAGAGGGGATGGGTGGCTTCAAGCTGGGCACTGCAGCCTGGCAGCCATGGGCACAATTCTCTAACCTCCACCAGCCAACCCCATTCTGG

AACCAGGTGTCAGCTGCAGGTGGGGACAGTCTCAGGTATGAACAGACACTTTGAAAGCACCTGAACAGGTTCCCAGTGTTTTAAAACAGGTTGATGATCC

AAAGACTCACGCCTCCCGCAGGCACGGCCAATACTTGCAATAGACTCAGGCTCGGTTGGGTTTTATACCCGATGTTCTACTGTGGCTCTCACACAAGCCA

TCTTACAGATCTGGAGGAGAGGCCAAGGAGTGAGCTGTGGGGTTTTTGGGGTTTTGTTTTGCTGCGGTCTCCTTATATACCCTGACTGGCCCTGGCCTAG

AACTCATAGAGATCTGCCTGCCTCTGTCTGCAGAGTACTGGGCTCAAAGGCGTGTGCTACCACACCACACCAGGCCAGGAGCAGATTTGCTTTGATTTTT

TTTTTTTTTTTTTTTTTTTTGAGACAGGGTTTCTCTGTGTAGCCCTAGCTTGTCCTTGAACTCATTCTATAGACCAGACTAACCTCAAATTCAGAGATCA

CCTGCCTCTGCCTTGAGAGTGCCAGGATTAAAGGGTGCGCCATGATGCCACATCCTGGTCTTTTGGCTTTTTTTTTTTTTTTTTAATAAGATATCAGTGA

GACATTCTACCCCACACGGCTAGAGAAGGACATCTGGAGCCTTGTAAAGGGAAAGACATGATAGCTAAGAAGGCCGAGGGACTTCATTCTGAGGAACAGC

CACTTCTGGCCAGGAGAAAATAATAACCCCTGTCCTGCCTGCCAAGGGACAGGTTAGGGGTCTTTGGTGCTTCCAACCTCTGACCAACCCAGAGTACACT

ACACACCGAAGCCCCGTGGCCTTGTGCAGCCAAGCGAGGCCCTACTGATGGTGCGGGACAGGGATGTGTCCATTTCAGAAGAGCCACATTGTCATTGTAC

TGGCAGCTCCCAGCCAAGCCACCGGCGTCACTGTGTCTCATATTAACCTGTGCATACTGTGAGCGACCTTTGTATGCCTGTGTCCTGTGCAGACTCGGAG

CTTTGACCTCAGGCCTTGCTCCTGATGTCTCCTCTGCAGCAGCTGAAGGACTTTTTAATGCATGTACATTAAACTAAAACTCCTCCGGGTTCTACAAGAG

TCGGGTGGGCAAACCTCTTCTTGATCCATGTTCGCCCTCCCCCAGAAATAAACCACTTCCCTT
Translation
MPAARVEYIAPWWVVWLHSVPHLGLRLQRVDSTFSPGDETYQE - UNI20198 - SLLFLGVLAAIGLGLNLIFLTVYLVCTCCCRRDHTVQTKQQES

CCVTWTAVVAGLLCC CAAVGVGFYGNSETNDGMHQLIYSLDNANHTFSGMDEL - UNI25927 - VSANTQRMKVDLEQHLARLSEIIAARGDYIQT

LKFMQQMAGNVVSQLSGLPVWREVTTQLTKLSHQTAYVEYYR RWLSYLLLFILDLVICLVTCLGLARRSKCLLAS SMLCCGILTLILSWASLAADAAA

AV GTSDFCMAPDIYILNNTGSQINSE EVTRYYLHCSQSLISPFQQ SLTTFQRSLTTMQIQVGGLLQFAVPLFPTAE KDLLGIQLLLNNSEISLHQL

TAMLDCRGLHK DYLDALTGICYDGIEGLLFLGLFSLLAALAFSTLTCAGPRAWKYFINR RNQAILFGGNPRYENVPLIGRGSPPPT - UNI28026 

- YSPSMRPTYMSVADEHLRHYEFPS

For any suggestions or comments, please send an email to unitrap@crg.es