Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000034751 (Mast4)
Chromosomal location
Chr 13: 103524891 - 104124541 (-)
Description
microtubule associated serine/threonine kinase family member 4 Gene [Source:MGI Symbol;Acc:MGI:1918885]
MGI
MGI:1918885 
Uniprot/SWISSPROT
Q811L6 
Human Ortholog
ENSG00000069020 (MAST4)
Omim not available
UniTrap UNI30004
Vector Insertion
Chr 13: 103815601 - 103930368
Public Clones D158E05 (ggtc) IST11018A4 (tigm) IST11110A10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30846
Vector Insertion
Chr 13: 103643910 - 103815634
Public Clones IST15033H5 (tigm) IST14975H3 (tigm) IST13071A10 (tigm) IST10556A7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37847
Vector Insertion
Chr 13: 103600580 - 103644000
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4859
Vector Insertion
Chr 13: 103560015 - 103560802
Public Clones AF0622 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5733
Vector Insertion
Chr 13: 103558053 - 103559848
Public Clones CSI184 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI731
Vector Insertion
Chr 13: 103528978 - 103529277
Public Clones DA0193 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000099202
Sequence
CAGTCCCGGCGGCTCGGGCGCAGCGCGGAGCGCCGATCGCGGTGGGCATGGCCCCGCGCGCGGGAGTCCATGTCAGCAGCCGAGCCACGGCGGCAGTGAA

CTTGGCGACGCGCTCCTGTGGTCCAACCTCTGTCATGTAGTCGCCGGCGGCGCTCCCCGCAGCCCGGGAGCCGCAGCGCGATCCAGACACAGCAGAGCAG

CCGGGGCTTCTTCGGGAGGCGCCGAGCGCACCGCCACCCCTCGGACGGCACTTTGGGCCGAAAAGGGACATGGGGGAGAAAGTTTCCGAGGCGCCTGAGC

CCGTGCCCCGGGGCTGCAGCGGACACGGCGCCCGGACCCTAGTCTCTTCGGCGGCAGCCGTGTCCTCGGAGGGCGCTTCCTCAGCGGAGTCATCCTCTGG

CTCGGAAACTCTGTCGGAGGAAGGGGAGCCCAGCCGCTTCTCCTGCAGGTCGCAGCCGCCGCGGCCGCCGGGCGGCGCCCTGGGAACCCGGCTACCCGCC

GCGTGGGCTCCCGCGCGCGTGGCTCTGGAGCGTGGAGTCCCTACCCTGCCGCTGCCGCACCCGGGAGGAGCGGTGCTGCCGGTGCCCCAGGTCAGCAGCG

CATCCCAAGAGGAGCAGGATGAAGAG CTTGACCACATACTGTCTCCGCCACCCATGCCGTTTCGGAAATGCAGCAACCCAGATGTGGCCTGCGGCCTCG

GAAAATCACTGAAGTACAAGAGACAGCTTAGTGAGGATGGGAAGCAGCTGCGGCGGGGGAGCCTGGGAGGAGCCCTCACAG - UNI30004 - GGAGG

TACCTCCTTCCAAACCCGGTAGCAGGACAGGCCTGGCCTGCTTCGGCGGAGACGTCCAACCTCGTGCGCATGCGCAGCCAGGCCCTTGGCCAATCGGCTC

CCTCGCTCACAGCCAGCTTG - UNI30004 - - UNI30846 - AAGGAGCTGAGCCTCCCCCGAAGAGGAAGTCT - UNI30004 - - UNI30

846 - TTGCCGAACAAGCAACCGGAAGAGTTTGATAGGCAATGGCCAGTCTCCAGCACTGCCTCGACCACACTCACCTCTCTCTGCTCATGCAG - UN

I30846 - GAAATAGCCCTCAAGACAGTCCAAGGAATTTCTCCCCCAGTGCCTCAGCCCATTTCTCATTTGCGAGGAG AACGGATGGGCGCCGCTGGT

CTCTGGCTTCTCTCCCTTCCTCAGGCTATGGGACAAATACCCCAAGCTCCACCGTCTCC TCATCCTGTTCTTCCCAGGAGAAGTTGCACCAGCTACCAT

ACCAGCCAACCCCAGATGAATTACACTTCTTATCCAAACACTTCTGCACAACAGAAAGTATCGCCACTGAGAACCGGTGCAGAAACACACCCATGCGTCC

ACGTTCCCGGAGTCTCAG CCCTGGACGGTCCCCCGCCTGCTGTGACCATGAAATAATTATGATGAACCATGTCTACAAAGAAAGGTTCCCAAAG GCCA

CAGCTCAGATGGAAGAGCGTCTGAAGGAGATCATCACCAGCTACTCTCCAGACCATGTTCTCCCCTTGGCAGATGGGGTACTTAGTTTCACTCACCATCA

GATCATTGAGCTGGCTCGGGACTGTTTGGATAAATCTCACCAGGGTCTCATCACGTCGAGATACTTTTTTGAGTTGCAGCACAAACTGGACAAGTTGCTC

CAGGAG GCTCACGATCGCTCTGAAAGTGGAGAACTGGCATTTATCAAGCAACTAGTCCGAAAGATCCTAATTGTCATTGCCCGCCCCGCTCGGTTATTG

GAGTGTTTG GAATTTGATCCTGAAGAATTTTATTACCTATTGGAAGCTGCAGAAGGCCATGCCAAAGAAGGCCAAGGAATCAAAACTGACATCCCTAGG

TATATCATCAGCCAGCTGGGACTCAATAAGGACCCTTTAGAAG AAATGGCTCAGTTGGGGAATTACGACAGTAGGACAGCAGAGACACCAGAGATGGAT

GAGTCAGTGAGT AGCTCAAATACTTCCCTGAGACTTCGAAGGAAACCCCGAGAGAGTGATTTTGAAACAATTAAATTGATCAGCAATGGAGCCTACGG 

GGCAGTCTACTTTGTTCGGCACAAAGAGTCCCGCCAGAGGTTTGCCATGAAGAAGATCAACAAGCAGAACCTCATCCTTCGGAACCAGATCCAGCAGGCC

TTCGTGGAGCGAGACATCCTGACTTTCGCAGAGAACCCCTTTGTGGTCAGCATGTATTGCTCCTTTGAAACGAGGCGTCACTTATGCATGGTCATGGAGT

ATGTAGAAG GGGGAGACTGTGCGACCCTAATGAAAAACATGGGACCTCTCCCAGTTGATATGGCCAGAATGTATTTCGCCGAGACCGTCTTGGCCTTGG

AGTACCTGCATAATTACGGAATCGTACACAGGGACTTGAAGCCAGACAA CCTGTTGGTCACCTCCATGGGGCACATAAAACTGACTGACTTCGGCTTGT

CTAAGGTGGGATTAATGAGCATGACCACCAATCTCTATGAAGGCCACATAGAGAAGGACGCTCGAGAGTTCTTAGATAAACAG - UNI4859 - GTCT

GTGGTACACCTGAGTACATTGCCCCCGAGGTGATTCTGAGACAGGGCTACGGGAAACCCGTGGACTGGTGGGCCATGGGCATTATCCTCTATGAATTTCT

GGTCGGATGTGTGCCTTTCTTTGGGGACACTCCAGAAGAGCTATTTGGACAAGTCATCAGTG - UNI5733 - ATGAAATCAACTGGCCTGAAAAGGA

CGAGGCCCCTCCTCCAGACGCTCAGGAGCTGATTACCTTGCTCCTCAGGCAGAATCCGCTGGAGAGGCTGGGAACAG GTGGAGCCTATGAAGTGAAGCA

GCATCGTTTCTTCCGCTCCTTAGACTGGAACAGTTTGCTGAGACAGAAGGCGGAATTTATTCCCCAACTGGAATCGGAGGATGACACAAGTTATTTTGAT

A CTCGGTCAGAGAAGTATCATCACATGGAGACGGAGGAGGAGGACGATACAAACGATGAGGACTTCACCGTGGAGATAAGGCAGTTTTCTTCCTGTTCA

CACAGGTTTTCAAAA GTTTTCAGCAGTATAGATCGCATAACTCAAAATTCAGGAGAAGACAAAGATGACTCTGAGGACAAGACCAAAAGCACAACGTTG

CCATCCACAGAGACACTCAGCTGGAGTTCCGAATACTCTGAAAT GCAACAGTTATCGACCTCCAACTCTTCAGATACTGAAAGCAACAGGTGCAAACTC

AGCTCTGGCTTGCTCCCCAAGCTGGCTATTTCGACAGATGGGGAACAAGATGAGGCTGTCCCTTGCTCTGGAGACCCCAGAGAGGAGCCAGAGAAACCTG

TCCCTCCCTCTGAGGAGTGTACTCAGGAGGAGCCCGAGGTCACCACCCCAGCCAGCACCATCAGCAGTTCCACACTGTCAG TTGGCAGTTTTTCAGAGC

ACTTGGATCAGATAAATGGGCGAAGCGAGTGTGTGGACAGTACAGATAATTCCTCAAAGCCATCCAGTGAACCCACTTCTCACGTGGCTCGACAGCGCTT

AGAAAGCACAGAGAAAAAGAAAATTTCTGGGAAAGTCACAAAGTCCCTCTCGGCCAGTGCTCTGTCCCTCATGATCCCAGGAG ATATGTTCGCTGTATC

TCCATTGGGAAGCCCAATGTCCCCACACTCCCTGTCTTCAGACCCTTCTTCTTCACGGGATTCCTCTCCCAGCCGAGACTCTTCTGCAGCATCTGCCAGT

CCGCATCAGCCCATTGTCATCCACAGCTCAGGCAAGAACTATGGGTTCACCATCCGTGCTATCCGCGTGTACGTGGGGGACAGTGACATCTACACAGTGC

ACCATATCGTCTGG AACGTAGAAGAAGGAAGTCCCGCATACCAGGCAGGACTGAAGGCCGGGGATCTGATCACACACATCAACGGAGAGCCGGTGCACG

GCCTCGTCCACACGGAAGTTATCGAGCTCCTGCTGAAG AGTGGGAATAAGGTGTCTATCACCACTACTCCATTTGAAAACACATCAATCAAAACGGGAC

CAGCCAGGAGAAACAGTTACAAGGGCCGGATGGTGAGACGAAGCAAGAAGTCCAAGAAGAAGGAGAGTCTAGAAAG GAGGAGATCTCTCTTCAAGAAGC

TGGCCAAGCAGCCTTCTCCTTTGCTCCACACCAGCCGAAGTTTCTCCTGCTTAAACCGGTCCCTGTCATCTGGAGAGAGCCTCCCGGGTTCCCCAACTCA

CAGCTTGTCCCCGAGGTCTCCAACACCCAGTTATCGTTCTACTCCCGATTTTCCGTCAG - UNI731 - GTACAAATTCCTCCCAGAGCAGCTCCCCA

AGTTCAAGTGCCCCCAATTCTCCAGCAGGTTCAGGGCACATCCGGCCCAGCACCCTCCATGGCCTGGCTCCCAAACTCAGCGGGCAGCGATACCGCTCTG

GAAGACGGAAGTCGGCTGGCAGCATCCCTCTCTCCCCGCTGGCCAGGACACCCTCTCCCACTCCACAGCCTACCTCTCCTCAGCGTTCACCATCCCCACT

GTTGGGACACTCACTGGGCAATGCCAAGATCACTCAGGCCTTTCCTAGCAAGATGCACTCTCCCCCCACAATCGTCAGACACATCGTGAGGCCCAAGAGT

GCAGAGCCGCCCCGCTCCCCACTGCTGAAACGGGTGCAGTCGGAGGAAAAGTTGTCACCCTCCTATGGCAGTGACAAGAAGCTTCTGTGCTCCCGCAAGC

ATAGCCTAGAGGTGACACAAGAGGAGGTACAGAGGGAGCAGTGTCAGCGGGAAGTGACACTGCAGAGCCTGGAAGAGAATGTGTGTGACGCTCCTTCCCT

CAGTCGGGCCAGGCCAGTGGAGCAAGGCTGTCTGAAACGCCCCGTGTCCCGGAAGGTGGGCAGGCAAGAGTCTGTGGATGACCTGGACCGGGACAAGCTG

AAAGCCAAGGTTGTCGTAAAGAAACCAGAAGAGAAACATGAATCGCACCAGAAACCTCACAGCCTTGGTGGTGATTCGGAAAGCTATGCTCTCTTCAGGC

TAGAGGAGAGAGAGAAAAAAGTGTACTCCAAGGGGTTGGAAAGGTCAGGCCATTTTGAAAACACATCAGCAGAGTTGCCTTCTGTGGGCAGCCTGCTGAA

GGACACTCTTCACAAGCAGGCCAGCGTGAGGGCCAGCGAGGGGGTGACCTCAGACGGGGCAGCTTGCAGCCTGACACCAGGGGAGCACAGCCAGTCTCTA

GGTGACTTTAAGCGGGCCTCAGCTTCTGGCATTCTCCATGATAGTGTGTGCCCCATCTCTGATAGGCCTGCTCCTGGAAAGGTTGAATACTCGGAGAAGG

CCTCTCAGGCCAAAGAGCTCCTTCGAAGTGAAAAACTAGACAGCAAGCTGGCCAATATTGATTACCTCAGAAAGAAAATGTCATTGGATGACAAAGATGA

CAGCCACTGTGCCATCCTGAAACCCAAGATAACATCTAGCGCCCATGAATGTCTGCCAGGGAACCCCATACGGCCCATGGCAGGGCAACAAGAGACCCCG

CCAGCCTCTGAAAACCGGGCATTCATCAACAGTACCCACACACCTCAGATGAGTGCAGTTTCCTTTGTTCCTCTCAAAGCCTTAGCTGGCCGGGTAGAGA

ACGGAGGGGAGAAAGCAGGCTTAGCTGCTCCCGAGTCCCCTGTCAGGAAGAGCCCCTCCGAGTATAAGCTAGAGGGCAGGTCAGTTTCATGTCTCAAGCC

GATCGAGGGCACACTGGACATTGCTCTCCTGTCTGGACCTCACGCCTCCAAAACAGAGTTGCTTTCCCCAGAGCCTGCACAGAGTCCCAGCCCAGGCATC

AACGTGGGACCATGTGTGCCACTAGCTCTTCCTGGGAGCAGTGGGAAAAAGGGAGACTCCACCAGCCTGAGAGAGCCTTCCTCAGCCAACTTAAAAGTAA

ATAAATCTTATCTGCTGGAGCCTCGGTTCCTACCCCCGAGCCGGGCTCTCCAGGACTCTCTCGCAGCCTCTGGGCCAGAACCGAAGTCAAAGCCGGAAAG

GAAGCTCATTCATCCTTCTGCCAGGAGCCCAGCAACTGTCACAGAGAGCAATCTTCAGCAGAAAGAGGGTGGTCCCGCCACACACCAAGACCGCTCCACT

GACACCAGGAACCTCCCTGGCCCAGGGCAGACCCTACACAATGTGGACCTACCCAGGCTGTGTACACGTGCCCCACTCCCACCGGAAGGGACGCCCGCAA

AGGAGAAGCCATGTCTGAAGGAACCCTCTGCCAAGGTGAAAAGCGAGTGGTCTGCCGTGAGGGATGACGGACACAGAGATCCCTGTGCGAAGCTGTGCCC

GGCAGAGACTGGTAAAGCCAGCGACAGTTCCAAACCCCTGCCTTCCGGGGGGAGGACCCAACCCGATTTCTACAAGCAGACCCAGACTTCGGAGAAAGCA

TGGGCGCATGCAAAAACAAACCACAAAGATAGCCAAGATGAGGTGAAGTCCCTGGCCAGGGAGGACTCAGCTTCACTTTTATATGAAAAGGAGATAGGCC

GGGCACGAAAAGGTCCTGAACCCAAACCGGAAGTTCCTGCTACCCGGTGCCCTCCTCAGCCACCAGGAATTGAGGGTGAGAAGCGAGAAAAGCTCTCCGC

TGCCCCCTCTTTGCAGAAACAGGCTCCCAAAGAGCCAGACAGGAAGGAACAGACTTCGCAAAGGCCTGGAGGTAGTGGCCCTCAACAACCCCCACCCACC

AAAGAGCTGTCTAACTCAGCATCCTGGCAGCACGGCAGTTCTCCGAGTCACACTTTAAAGAAGGAGCCCGGGACCAAAGCTGCCGCTGCAGAACCAAGCA

CCAGCCTTCATGACACTCCCCGATCTGC TGCCGGGCACAGTGACTGCAGTAGCCATAAGGCCCGGCCTGGCCCTGACCCCAGCCCTTCAAAGTCTAAGC

ACCAAGACAGGTCCCTCTCCTCACAGAAGCTGAGTGCTGGCTCTGCAAAAGGCAAAGAGCCTGTCACTCAACCCCTGGGTGGTTCCATCAGAGAAGGCAA

GGGTGGCAGCAAGGGTCCAGTGGACACATTTTCTGCTGTCCTGACCACCCAGGGCAAAGCAAGTGATGTGCTTGTGCAGGGAGAAGGTCGGGTCTCAATC

ATTGTCCACACTGAAGAGTGTCCTCTCGATGCCAAACTGAAAAACACCAATGGAGGGTGTCCCCCAGAGATGCAGGCGAAGCATCCACCCAGACAAGGAC

ATCTCAGTGAAGCAGCAGACCAGAAGCCACTCATTGCTGGTGAGAAGCAAAGCCCGTCTCCAAAGCATCCCAAACCATCCACTGTGAAAGATTACCCCAG

TCTGTGCAGACAGACAGACAGAAGCCCAAGCCATCAGGCTACCACTGGGGACAGGAAGGCAGAAGGAAAGAAATGCACAGACGCACTTTATGTCGCAGCC

CCAGAGGGCTACAAGCCAGAGGCCAGCCCTTCTCTCCACCACGGCGAGACCGGACTCAGAGGCTCAGAGAGGCCACCCATGGGCATGGGGAAGGGCTTCT

CTGAGCCCAAGGGGAAAGGGCCAGGTCCCCAGAAGTCACTGGCTGAAACAGGCAAGCCCAGCGGTATGAAAAGGTCACCCTCTGCCACCGTGCAGAGCTC

TCTCCGCTCAGCTGCCCCCCCAGAAAAGTCTCTGAGTTACTCAGCCAGCTTTCCCGAGGCCCAGCCTGGAGTGCGAGAGGTCCCTGCAGCCAACAGCAGC

CCCTCATCTGCCAAGGCTACAGGGGGGACCTCAGAGTTCCCAGCCCCCAGCAGCAGGGACCACAGGAAGCTTCAGTCTGGAGGAGACGGCCGAAGCCAAA

TGATAAAGAGTGACTCTCTGCCCTCCTTCCGCCTCTCCACCTCTGCTCTGGAGTCACATTTCCAGGATCCACAGGTGCCCATCGCATCAGGCCACCGAGG

CAGGGCACTGTCAGTAACTGCTGCCACAGGAGAACCCAAAGGGAGAGAGCTCGCCCAGCCTCCCCCAGTCAGGAAACAGAATGCGTGCAGAGAGGCGACC

AGAGCACCCCCAGCCCCAAGCACAGATCGCTCCCTCCCTCTTTCCTCAGAGAAAGACTTCGTGGTTCGGCAGAGAAGGGGCAAGGAGACCTTAAGGAGCA

GTCCTCACAAAAAGGCC
Translation
  - UNI30004 -  - UNI30004 - - UNI30846 -  - UNI30004 - - UNI30846 -  - UNI30846 -     MEERLKEIITSYS

PDHVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRYFFELQHKLDKLLQE AHDRSESGELAFIKQLVRKILIVIARPARLLECL EFDPEEFYYLL

EAAEGHAKEGQGIKTDIPRYIISQLGLNKDPLEE EMAQLGNYDSRTAETPEMDESVS SSNTSLRLRRKPRESDFETIKLISNGAYG GAVYFVRHKES

RQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEG GGDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIV

HRDLKPDN NLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREFLDKQ - UNI4859 - VCGTPEYIAPEVILRQGYGKPVDWWAMGIILYE

FLVGCVPFFGDTPEELFGQVISD - UNI5733 - DEINWPEKDEAPPPDAQELITLLLRQNPLERLGTG GGAYEVKQHRFFRSLDWNSLLRQKAEFI

PQLESEDDTSYFDT TRSEKYHHMETEEEDDTNDEDFTVEIRQFSSCSHRFSK VFSSIDRITQNSGEDKDDSEDKTKSTTLPSTETLSWSSEYSEM MQ

QLSTSNSSDTESNRCKLSSGLLPKLAISTDGEQDEAVPCSGDPREEPEKPVPPSEECTQEEPEVTTPASTISSSTLSV VGSFSEHLDQINGRSECVDST

DNSSKPSSEPTSHVARQRLESTEKKKISGKVTKSLSASALSLMIPGD DMFAVSPLGSPMSPHSLSSDPSSSRDSSPSRDSSAASASPHQPIVIHSSGKN

YGFTIRAIRVYVGDSDIYTVHHIVW NVEEGSPAYQAGLKAGDLITHINGEPVHGLVHTEVIELLLK SGNKVSITTTPFENTSIKTGPARRNSYKGRMV

RRSKKSKKKESLER RRRSLFKKLAKQPSPLLHTSRSFSCLNRSLSSGESLPGSPTHSLSPRSPTPSYRSTPDFPSG - UNI731 - GTNSSQSSSPS

SSAPNSPAGSGHIRPSTLHGLAPKLSGQRYRSGRRKSAGSIPLSPLARTPSPTPQPTSPQRSPSPLLGHSLGNAKITQAFPSKMHSPPTIVRHIVRPKSA

EPPRSPLLKRVQSEEKLSPSYGSDKKLLCSRKHSLEVTQEEVQREQCQREVTLQSLEENVCDAPSLSRARPVEQGCLKRPVSRKVGRQESVDDLDRDKLK

AKVVVKKPEEKHESHQKPHSLGGDSESYALFRLEEREKKVYSKGLERSGHFENTSAELPSVGSLLKDTLHKQASVRASEGVTSDGAACSLTPGEHSQSLG

DFKRASASGILHDSVCPISDRPAPGKVEYSEKASQAKELLRSEKLDSKLANIDYLRKKMSLDDKDDSHCAILKPKITSSAHECLPGNPIRPMAGQQETPP

ASENRAFINSTHTPQMSAVSFVPLKALAGRVENGGEKAGLAAPESPVRKSPSEYKLEGRSVSCLKPIEGTLDIALLSGPHASKTELLSPEPAQSPSPGIN

VGPCVPLALPGSSGKKGDSTSLREPSSANLKVNKSYLLEPRFLPPSRALQDSLAASGPEPKSKPERKLIHPSARSPATVTESNLQQKEGGPATHQDRSTD

TRNLPGPGQTLHNVDLPRLCTRAPLPPEGTPAKEKPCLKEPSAKVKSEWSAVRDDGHRDPCAKLCPAETGKASDSSKPLPSGGRTQPDFYKQTQTSEKAW

AHAKTNHKDSQDEVKSLAREDSASLLYEKEIGRARKGPEPKPEVPATRCPPQPPGIEGEKREKLSAAPSLQKQAPKEPDRKEQTSQRPGGSGPQQPPPTK

ELSNSASWQHGSSPSHTLKKEPGTKAAAAEPSTSLHDTPRSA AAGHSDCSSHKARPGPDPSPSKSKHQDRSLSSQKLSAGSAKGKEPVTQPLGGSIREG

KGGSKGPVDTFSAVLTTQGKASDVLVQGEGRVSIIVHTEECPLDAKLKNTNGGCPPEMQAKHPPRQGHLSEAADQKPLIAGEKQSPSPKHPKPSTVKDYP

SLCRQTDRSPSHQATTGDRKAEGKKCTDALYVAAPEGYKPEASPSLHHGETGLRGSERPPMGMGKGFSEPKGKGPGPQKSLAETGKPSGMKRSPSATVQS

SLRSAAPPEKSLSYSASFPEAQPGVREVPAANSSPSSAKATGGTSEFPAPSSRDHRKLQSGGDGRSQMIKSDSLPSFRLSTSALESHFQDPQVPIASGHR

GRALSVTAATGEPKGRELAQPPPVRKQNACREATRAPPAPSTDRSLPLSSEKDFVVRQRRGKETLRSSPHKKA
Transcript ENSMUST00000091273
Sequence
CAGTCCCGGCGGCTCGGGCGCAGCGCGGAGCGCCGATCGCGGTGGGCATGGCCCCGCGCGCGGGAGTCCATGTCAGCAGCCGAGCCACGGCGGCAGTGAA

CTTGGCGACGCGCTCCTGTGGTCCAACCTCTGTCATGTAGTCGCCGGCGGCGCTCCCCGCAGCCCGGGAGCCGCAGCGCGATCCAGACACAGCAGAGCAG

CCGGGGCTTCTTCGGGAGGCGCCGAGCGCACCGCCACCCCTCGGACGGCACTTTGGGCCGAAAAGGGACATGGGGGAGAAAGTTTCCGAGGCGCCTGAGC

CCGTGCCCCGGGGCTGCAGCGGACACGGCGCCCGGACCCTAGTCTCTTCGGCGGCAGCCGTGTCCTCGGAGGGCGCTTCCTCAGCGGAGTCATCCTCTGG

CTCGGAAACTCTGTCGGAGGAAGGGGAGCCCAGCCGCTTCTCCTGCAGGTCGCAGCCGCCGCGGCCGCCGGGCGGCGCCCTGGGAACCCGGCTACCCGCC

GCGTGGGCTCCCGCGCGCGTGGCTCTGGAGCGTGGAGTCCCTACCCTGCCGCTGCCGCACCCGGGAGGAGCGGTGCTGCCGGTGCCCCAGGTCAGCAGCG

CATCCCAAGAGGAGCAGGATGAAGAG CTTGACCACATACTGTCTCCGCCACCCATGCCGTTTCGGAAATGCAGCAACCCAGATGTGGCCTGCGGCCTCG

GAAAATCACTGAAGTACAAGAGACAGCTTAGTGAGGATGGGAAGCAGCTGCGGCGGGGGAGCCTGGGAGGAGCCCTCACAG - UNI30004 - GGAGG

TACCTCCTTCCAAACCCGGTAGCAGGACAGGCCTGGCCTGCTTCGGCGGAGACGTCCAACCTCGTGCGCATGCGCAGCCAGGCCCTTGGCCAATCGGCTC

CCTCGCTCACAGCCAGCTTG - UNI30004 - - UNI30846 - AAGGAGCTGAGCCTCCCCCGAAGAGGAAGTCT - UNI30004 - - UNI30

846 - TTGCCGAACAAGCAACCGGAAGAGTTTGATAGGCAATGGCCAGTCTCCAGCACTGCCTCGACCACACTCACCTCTCTCTGCTCATGCAG - UN

I30846 - GAAATAGCCCTCAAGACAGTCCAAGGAATTTCTCCCCCAGTGCCTCAGCCCATTTCTCATTTGCGAGGAG AACGGATGGGCGCCGCTGGT

CTCTGGCTTCTCTCCCTTCCTCAGGCTATGGGACAAATACCCCAAGCTCCACCGTCTCC TCATCCTGTTCTTCCCAGGAGAAGTTGCACCAGCTACCAT

ACCAGCCAACCCCAGATGAATTACACTTCTTATCCAAACACTTCTGCACAACAGAAAGTATCGCCACTGAGAACCGGTGCAGAAACACACCCATGCGTCC

ACGTTCCCGGAGTCTCAG CCCTGGACGGTCCCCCGCCTGCTGTGACCATGAAATAATTATGATGAACCATGTCTACAAAGAAAGGTTCCCAAAG GCCA

CAGCTCAGATGGAAGAGCGTCTGAAGGAGATCATCACCAGCTACTCTCCAGACCATGTTCTCCCCTTGGCAGATGGGGTACTTAGTTTCACTCACCATCA

GATCATTGAGCTGGCTCGGGACTGTTTGGATAAATCTCACCAGGGTCTCATCACGTCGAGATACTTTTTTGAGTTGCAGCACAAACTGGACAAGTTGCTC

CAGGAG GCTCACGATCGCTCTGAAAGTGGAGAACTGGCATTTATCAAGCAACTAGTCCGAAAGATCCTAATTGTCATTGCCCGCCCCGCTCGGTTATTG

GAGTGTTTG GAATTTGATCCTGAAGAATTTTATTACCTATTGGAAGCTGCAGAAGGCCATGCCAAAGAAGGCCAAGGAATCAAAACTGACATCCCTAGG

TATATCATCAGCCAGCTGGGACTCAATAAGGACCCTTTAGAAG AAATGGCTCAGTTGGGGAATTACGACAGTAGGACAGCAGAGACACCAGAGATGGAT

GAGTCAGTGAGT AGCTCAAATACTTCCCTGAGACTTCGAAGGAAACCCCGAGAGAGTGATTTTGAAACAATTAAATTGATCAGCAATGGAGCCTACGG 

GGCAGTCTACTTTGTTCGGCACAAAGAGTCCCGCCAGAGGTTTGCCATGAAGAAGATCAACAAGCAGAACCTCATCCTTCGGAACCAGATCCAGCAGGCC

TTCGTGGAGCGAGACATCCTGACTTTCGCAGAGAACCCCTTTGTGGTCAGCATGTATTGCTCCTTTGAAACGAGGCGTCACTTATGCATGGTCATGGAGT

ATGTAGAAG GGGGAGACTGTGCGACCCTAATGAAAAACATGGGACCTCTCCCAGTTGATATGGCCAGAATGTATTTCGCCGAGACCGTCTTGGCCTTGG

AGTACCTGCATAATTACGGAATCGTACACAGGGACTTGAAGCCAGACAA CCTGTTGGTCACCTCCATGGGGCACATAAAACTGACTGACTTCGGCTTGT

CTAAGGTGGGATTAATGAGCATGACCACCAATCTCTATGAAGGCCACATAGAGAAGGACGCTCGAGAGTTCTTAGATAAACAG - UNI4859 - GTCT

GTGGTACACCTGAGTACATTGCCCCCGAGGTGATTCTGAGACAGGGCTACGGGAAACCCGTGGACTGGTGGGCCATGGGCATTATCCTCTATGAATTTCT

GGTCGGATGTGTGCCTTTCTTTGGGGACACTCCAGAAGAGCTATTTGGACAAGTCATCAGTG - UNI5733 - ATGAAATCAACTGGCCTGAAAAGGA

CGAGGCCCCTCCTCCAGACGCTCAGGAGCTGATTACCTTGCTCCTCAGGCAGAATCCGCTGGAGAGGCTGGGAACAG GTGGAGCCTATGAAGTGAAGCA

GCATCGTTTCTTCCGCTCCTTAGACTGGAACAGTTTGCTGAGACAGAAGGCGGAATTTATTCCCCAACTGGAATCGGAGGATGACACAAGTTATTTTGAT

A CTCGGTCAGAGAAGTATCATCACATGGAGACGGAGGAGGAGGACGATACAAACGATGAGGACTTCACCGTGGAGATAAGGCAGTTTTCTTCCTGTTCA

CACAGGTTTTCAAAA GTTTTCAGCAGTATAGATCGCATAACTCAAAATTCAGGAGAAGACAAAGATGACTCTGAGGACAAGACCAAAAGCACAACGTTG

CCATCCACAGAGACACTCAGCTGGAGTTCCGAATACTCTGAAAT GCAACAGTTATCGACCTCCAACTCTTCAGATACTGAAAGCAACAGGTGCAAACTC

AGCTCTGGCTTGCTCCCCAAGCTGGCTATTTCGACAGATGGGGAACAAGATGAGGCTGTCCCTTGCTCTGGAGACCCCAGAGAGGAGCCAGAGAAACCTG

TCCCTCCCTCTGAGGAGTGTACTCAGGAGGAGCCCGAGGTCACCACCCCAGCCAGCACCATCAGCAGTTCCACACTGTCAG ATATGTTCGCTGTATCTC

CATTGGGAAGCCCAATGTCCCCACACTCCCTGTCTTCAGACCCTTCTTCTTCACGGGATTCCTCTCCCAGCCGAGACTCTTCTGCAGCATCTGCCAGTCC

GCATCAGCCCATTGTCATCCACAGCTCAGGCAAGAACTATGGGTTCACCATCCGTGCTATCCGCGTGTACGTGGGGGACAGTGACATCTACACAGTGCAC

CATATCGTCTGG AACGTAGAAGAAGGAAGTCCCGCATACCAGGCAGGACTGAAGGCCGGGGATCTGATCACACACATCAACGGAGAGCCGGTGCACGGC

CTCGTCCACACGGAAGTTATCGAGCTCCTGCTGAAG AGTGGGAATAAGGTGTCTATCACCACTACTCCATTTGAAAACACATCAATCAAAACGGGACCA

GCCAGGAGAAACAGTTACAAGGGCCGGATGGTGAGACGAAGCAAGAAGTCCAAGAAGAAGGAGAGTCTAGAAAG - UNI731 - AAGGAGGAGGAGAG

ACAGG AAAAAAAAAAGGGAACTTTCTTCCAGATGCCTTCCCAGTAGTAACCGGTAA
Translation
  - UNI30004 -  - UNI30004 - - UNI30846 -  - UNI30004 - - UNI30846 -  - UNI30846 -     MEERLKEIITSYS

PDHVLPLADGVLSFTHHQIIELARDCLDKSHQGLITSRYFFELQHKLDKLLQE AHDRSESGELAFIKQLVRKILIVIARPARLLECL EFDPEEFYYLL

EAAEGHAKEGQGIKTDIPRYIISQLGLNKDPLEE EMAQLGNYDSRTAETPEMDESVS SSNTSLRLRRKPRESDFETIKLISNGAYG GAVYFVRHKES

RQRFAMKKINKQNLILRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEG GGDCATLMKNMGPLPVDMARMYFAETVLALEYLHNYGIV

HRDLKPDN NLLVTSMGHIKLTDFGLSKVGLMSMTTNLYEGHIEKDAREFLDKQ - UNI4859 - VCGTPEYIAPEVILRQGYGKPVDWWAMGIILYE

FLVGCVPFFGDTPEELFGQVISD - UNI5733 - DEINWPEKDEAPPPDAQELITLLLRQNPLERLGTG GGAYEVKQHRFFRSLDWNSLLRQKAEFI

PQLESEDDTSYFDT TRSEKYHHMETEEEDDTNDEDFTVEIRQFSSCSHRFSK VFSSIDRITQNSGEDKDDSEDKTKSTTLPSTETLSWSSEYSEM MQ

QLSTSNSSDTESNRCKLSSGLLPKLAISTDGEQDEAVPCSGDPREEPEKPVPPSEECTQEEPEVTTPASTISSSTLSD DMFAVSPLGSPMSPHSLSSDP

SSSRDSSPSRDSSAASASPHQPIVIHSSGKNYGFTIRAIRVYVGDSDIYTVHHIVW NVEEGSPAYQAGLKAGDLITHINGEPVHGLVHTEVIELLLK S

GNKVSITTTPFENTSIKTGPARRNSYKGRMVRRSKKSKKKESLER - UNI731 - RRRRRDR KKKRELSSRCLPSSNR

For any suggestions or comments, please send an email to unitrap@crg.es